Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Plaque-size/host range protein (PS/HR) Recombinant Protein | PS/HR recombinant protein

Recombinant Vaccinia virus Plaque-size/host range protein (PS/HR), partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Plaque-size/host range protein (PS/HR); Recombinant Vaccinia virus Plaque-size/host range protein (PS/HR); partial; Recombinant Plaque-size/host range protein (PS/HR); Plaque-size/host range protein; Protein B5; PS/HR recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
18-279aa; Partial
Sequence
YSTCTVPTMNNAKLTSTETSFNNNQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH
Species
Vaccinia virus (strain Copenhagen) (VACV)
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
31.1 kDa
NCBI Official Full Name
Plaque-size/host range protein
UniProt Protein Name
Plaque-size/host range protein
UniProt Gene Name
PS/HR
UniProt Entry Name
B5_VACCC

Uniprot Description

Function: Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EEV) to allow virion entry into host cells. Participates also in wrapping intracellular mature virions (IMV) to form intracellular enveloped virions (IEV)

By similarity.

Subunit structure: Interacts with A33; this interaction is required for efficient targeting of A33 and B5 into enveloped virions. Interacts with A34; this interaction is required for the correct glycosylation, trafficking and stability of A34 and B5 incorporation into extracellular enveloped virions

By similarity.

Subcellular location: Host membrane; Single-pass type I membrane protein

Potential. Virion. Note: B5 is found on extracellular virions but not on intracellular mature virions

By similarity.

Sequence similarities: Belongs to the receptors of complement activation (RCA) family.Contains 4 Sushi (CCP/SCR) domains.

Similar Products

Product Notes

The Plaque-size/host range protein (PS/HR) ps/hr (Catalog #AAA1095684) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-279aa; Partial. The amino acid sequence is listed below: YSTCTVPTMN NAKLTSTETS FNNNQKVTFT CDQGYHSSDP NAVCETDKWK YENPCKKMCT VSDYISELYN KPLYEVNSTM TLSCNGETKY FRCEEKNGNT SWNDTVTCPN AECQPLQLEH GSCQPVKEKY SFGEYMTINC DVGYEVIGAS YISCTANSWN VIPSCQQKCD IPSLSNGLIS GSTFSIGGVI HLSCKSGFIL TGSPSSTCID GKWNPVLPIC VRTNEEFDPV DDGPDDETDL SKLSKDVVQY EQEIESLEAT YH. It is sometimes possible for the material contained within the vial of "Plaque-size/host range protein (PS/HR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.