cAMP-dependent protein kinase catalytic subunit beta (PRKACB) Recombinant Protein | PRKACB recombinant protein

Recombinant Bovine cAMP-dependent protein kinase catalytic subunit beta (PRKACB)

Cat. Num. AAA949154

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: cAMP-dependent protein kinase catalytic subunit beta (PRKACB); Recombinant Bovine cAMP-dependent protein kinase catalytic subunit beta (PRKACB); PRKACB recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-351, Full length protein
• Sequence: GNAATAKKGSEVESVKEFLAKAKEDFLKKWENPAPNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCGKEFCEF
• Sequence Length: 350

• Species: Bovine
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for PRKACB recombinant protein

cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. This protein is a member of the Ser
Thr protein kinase family and is a catalytic subunit of cAMP-dependent protein kinase. Three alternatively spliced transcript variants encoding distinct isoforms have been observed.

NCBI and Uniprot Product Information

• NCBI GI #: 27807059
• NCBI GeneID: 282323
• NCBI Accession #: NP_777010.1
• NCBI GenBank Nucleotide #: NM_174585.3
• UniProt Accession #: P05131; P24256
• Molecular Weight: 46,108 Da
• NCBI Official Full Name: cAMP-dependent protein kinase catalytic subunit beta
• NCBI Official Synonym Full Names: protein kinase cAMP-activated catalytic subunit beta
• NCBI Official Symbol: PRKACB
• NCBI Protein Information: cAMP-dependent protein kinase catalytic subunit beta
• UniProt Protein Name: cAMP-dependent protein kinase catalytic subunit beta
• Protein Family: cAMP-dependent protein kinase
• UniProt Gene Name: PRKACB
• UniProt Synonym Gene Names: PKA C-beta

Uniprot Description

Mediates cAMP-dependent signaling triggered by receptor binding to GPCRs. PKA activation regulates diverse cellular processes such as cell proliferation, the cell cycle, and differentiation and regulation of microtubule dynamics, chromatin condensation and decondensation, nuclear envelope disassembly and reassembly, as well as regulation of intracellular transport mechanisms and ion flux. Regulates the abundance of compartmentalized pools of its regulatory subunits through phosphorylation of PJA2 which binds and ubiquitinates these subunits, leading to their subsequent proteolysis. Phosphorylates GPKOW which regulates its ability to bind RNA.