Peroxiredoxin-2 (PRDX2) Recombinant Protein | PRDX2 recombinant protein
Recombinant Pig Peroxiredoxin-2 (PRDX2)
Gene Names
PRDX2; TSA; TDPX1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Peroxiredoxin-2 (PRDX2); Recombinant Pig Peroxiredoxin-2 (PRDX2); PRDX2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-127, Full length protein
Sequence
LFFYPLDFTFVCPTEIIAFSDRAEEFHQLGCEVLGVSVDXQXTHLAWINTPRKEGGLGPLKIPLLADVTRNLSLDYGVLKEDEGIAYRGLFIIDGKGVLRQITVNDLPVGRXVDEALRLVQGXQYTD
Sequence Length
127
Species
Sus scrofa (Pig)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for PRDX2 recombinant protein
This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. The crystal structure of this protein has been resolved to 2.7 angstroms. Transcript variants encoding distinct isoforms have been identified for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
14,168 Da
NCBI Official Full Name
Peroxiredoxin-2
NCBI Official Symbol
PRDX2
NCBI Official Synonym Symbols
TSA; TDPX1
NCBI Protein Information
peroxiredoxin-2
UniProt Protein Name
Peroxiredoxin-2
Protein Family
UniProt Gene Name
PRDX2
UniProt Synonym Gene Names
TDPX1; TSA
Uniprot Description
Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2.
Similar Products
Product Notes
The PRDX2 prdx2 (Catalog #AAA1063600) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-127, Full length protein. The amino acid sequence is listed below: LFFYPLDFTF VCPTEIIAFS DRAEEFHQLG CEVLGVSVDX QXTHLAWINT PRKEGGLGPL KIPLLADVTR NLSLDYGVLK EDEGIAYRGL FIIDGKGVLR QITVNDLPVG RXVDEALRLV QGXQYTD. It is sometimes possible for the material contained within the vial of "Peroxiredoxin-2 (PRDX2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
