Protein phosphatase 1 regulatory subunit 3C (Ppp1r3c) Recombinant Protein | Ppp1r3c recombinant protein
Recombinant Mouse Protein phosphatase 1 regulatory subunit 3C (Ppp1r3c)
Gene Names
Ppp1r3c; PTG; Ppp1r5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein phosphatase 1 regulatory subunit 3C (Ppp1r3c); Recombinant Mouse Protein phosphatase 1 regulatory subunit 3C (Ppp1r3c); Ppp1r3c recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-317, full length protein
Sequence
MSCTRMIHVLDPRPLTSSVMPVDMAMRICLAHSPPLKSFLGPYNGFQRRNFVNKLKPLKPCLSVKQEAKSQSEWKSPHNQAKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDLNDISSSLKLHEEKNLVFDFPQPSTDYLSFRDRFQKNFVCLENCSLQDRTVTGTVKVKNVSFEKKVQVRITFDTWKTYTDVDCVYMKNVYSSSDSDTFSFAIDLPRVIPTEEKIEFCISYHANGRIFWDNNEGQNYRIVHVQWKPDGVQTQVAPKDCAFQQGPPKTEIEPTVFGSPRLASGLFPEWQSWGRVENLTSYR
Sequence Length
317
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
36,460 Da
NCBI Official Full Name
protein phosphatase 1 regulatory subunit 3C
NCBI Official Synonym Full Names
protein phosphatase 1, regulatory (inhibitor) subunit 3C
NCBI Official Symbol
Ppp1r3c
NCBI Official Synonym Symbols
PTG; Ppp1r5
NCBI Protein Information
protein phosphatase 1 regulatory subunit 3C
UniProt Protein Name
Protein phosphatase 1 regulatory subunit 3C
Protein Family
UniProt Gene Name
Ppp1r3c
UniProt Synonym Gene Names
PP1 subunit R5; PTG
Uniprot Description
Acts as a glycogen-targeting subunit for PP1 and regulates its activity. Activates glycogen synthase, reduces glycogen phosphorylase activity and limits glycogen breakdown. Dramatically increases basal and insulin-stimulated glycogen synthesis upon overexpression in a variety of cell types.
Research Articles on Ppp1r3c
Similar Products
Product Notes
The Ppp1r3c ppp1r3c (Catalog #AAA1331111) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-317, full length protein. The amino acid sequence is listed below: MSCTRMIHVL DPRPLTSSVM PVDMAMRICL AHSPPLKSFL GPYNGFQRRN FVNKLKPLKP CLSVKQEAKS QSEWKSPHNQ AKKRVVFADS KGLSLTAIHV FSDLPEEPAW DLQFDLLDLN DISSSLKLHE EKNLVFDFPQ PSTDYLSFRD RFQKNFVCLE NCSLQDRTVT GTVKVKNVSF EKKVQVRITF DTWKTYTDVD CVYMKNVYSS SDSDTFSFAI DLPRVIPTEE KIEFCISYHA NGRIFWDNNE GQNYRIVHVQ WKPDGVQTQV APKDCAFQQG PPKTEIEPTV FGSPRLASGL FPEWQSWGRV ENLTSYR. It is sometimes possible for the material contained within the vial of "Protein phosphatase 1 regulatory subunit 3C (Ppp1r3c), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
