Protein phosphatase 1 regulatory subunit 3B (Ppp1r3b) Recombinant Protein | Ppp1r3b recombinant protein
Recombinant Mouse Protein phosphatase 1 regulatory subunit 3B (Ppp1r3b)
Gene Names
Ppp1r3b; GL; PTG; AW821953; 6430576E21
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein phosphatase 1 regulatory subunit 3B (Ppp1r3b); Recombinant Mouse Protein phosphatase 1 regulatory subunit 3B (Ppp1r3b); Ppp1r3b recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-284, full length protein
Sequence
MAVDIQYSYSSMAPSLRRERFTFKISPKLSKPLRPCIQLGSKDEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDIPFNITELLDNIVSLTTAESESFVLDFPQPSADYLDFRNRLQTNHVCLENCVLKDKAIAGTVKVQNLAFEKVVKIRMTFDTWKSFTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVCYECNGQAYWDSNKGKNYRITRAELRSSPGKIEPYNGPDFGISFDQFGSPRCSFGLFPEWPSYLGYEKLGPYY
Sequence Length
284
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
32,433 Da
NCBI Official Full Name
protein phosphatase 1 regulatory subunit 3B
NCBI Official Synonym Full Names
protein phosphatase 1, regulatory (inhibitor) subunit 3B
NCBI Official Symbol
Ppp1r3b
NCBI Official Synonym Symbols
GL; PTG; AW821953; 6430576E21
NCBI Protein Information
protein phosphatase 1 regulatory subunit 3B
UniProt Protein Name
Protein phosphatase 1 regulatory subunit 3B
Protein Family
UniProt Gene Name
Ppp1r3b
UniProt Synonym Gene Names
Ppp1r4; PP1 subunit R4; PTG
Uniprot Description
Acts as a glycogen-targeting subunit for phosphatase PP1. Facilitates interaction of the PP1 with enzymes of the glycogen metabolism and regulates its activity. Suppresses the rate at which PP1 dephosphorylates (inactivates) glycogen phosphorylase and enhances the rate at which it activates glycogen synthase and therefore limits glycogen breakdown. Its activity is inhibited by PYGL, resulting in inhibition of the glycogen synthase and glycogen phosphorylase phosphatase activities of PP1. Dramatically increases basal and insulin-stimulated glycogen synthesis upon overexpression in hepatocytes ().
Research Articles on Ppp1r3b
Similar Products
Product Notes
The Ppp1r3b ppp1r3b (Catalog #AAA1358826) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-284, full length protein. The amino acid sequence is listed below: MAVDIQYSYS SMAPSLRRER FTFKISPKLS KPLRPCIQLG SKDEASGMVA PAVQEKKVKK RVSFADNQGL ALTMVKVFSE FDDPLDIPFN ITELLDNIVS LTTAESESFV LDFPQPSADY LDFRNRLQTN HVCLENCVLK DKAIAGTVKV QNLAFEKVVK IRMTFDTWKS FTDFPCQYVK DTYAGSDRDT FSFDISLPEK IQSYERMEFA VCYECNGQAY WDSNKGKNYR ITRAELRSSP GKIEPYNGPD FGISFDQFGS PRCSFGLFPE WPSYLGYEKL GPYY. It is sometimes possible for the material contained within the vial of "Protein phosphatase 1 regulatory subunit 3B (Ppp1r3b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
