Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Protein phosphatase 1 regulatory subunit 1B (PPP1R1B) Recombinant Protein | PPP1R1B recombinant protein

Recombinant Human Protein phosphatase 1 regulatory subunit 1B (PPP1R1B)

Gene Names
PPP1R1B; DARPP32; DARPP-32
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein phosphatase 1 regulatory subunit 1B (PPP1R1B); Recombinant Human Protein phosphatase 1 regulatory subunit 1B (PPP1R1B); Protein phosphatase 1 regulatory subunit 1B; DARPP-32; Dopamine- and cAMP-regulated neuronal phosphoprotein; PPP1R1B recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-168aa; Full Length of Isoform 2
Sequence
MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT
Sequence Length
204
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for PPP1R1B recombinant protein
Inhibitor of protein-phosphatase 1.
Product Categories/Family for PPP1R1B recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45.7 kDa
NCBI Official Full Name
protein phosphatase 1 regulatory subunit 1B isoform 2
NCBI Official Synonym Full Names
protein phosphatase 1, regulatory (inhibitor) subunit 1B
NCBI Official Symbol
PPP1R1B
NCBI Official Synonym Symbols
DARPP32; DARPP-32
NCBI Protein Information
protein phosphatase 1 regulatory subunit 1B; dopamine and cAMP-regulated neuronal phosphoprotein 32
UniProt Protein Name
Protein phosphatase 1 regulatory subunit 1B
UniProt Gene Name
PPP1R1B
UniProt Synonym Gene Names
DARPP32
UniProt Entry Name
PPR1B_HUMAN

NCBI Description

This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

DARPP-32: a member of the protein phosphatase inhibitor 1 family. A dopamine- and cyclic AMP-regulated neuronal phosphoprotein. Both dopaminergic and glutamatergic (NMDA) receptor stimulation regulate the extent of DARPP32 phosphorylation, but in opposite directions. Dopamine D1 receptor stimulation enhances cAMP formation, resulting in the phosphorylation of DARPP32; phosphorylated DARPP32 is a potent protein phosphatase-1 inhibitor. NMDA receptor stimulation elevates intracellular calcium, which leads to activation of calcineurin and dephosphorylation of phospho-DARPP32, thereby reducing the phosphatase-1 inhibitory activity of DARPP32. Two alternatively-spliced isoforms have been described.

Protein type: Protein phosphatase, regulatory subunit; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: cell soma; cytoplasm; nucleus; cytosol

Molecular Function: protein kinase inhibitor activity; protein phosphatase type 1 regulator activity; D4 dopamine receptor binding; protein phosphatase inhibitor activity; type 1 serine/threonine specific protein phosphatase inhibitor activity; D3 dopamine receptor binding; D1 dopamine receptor binding; D5 dopamine receptor binding; D2 dopamine receptor binding

Biological Process: negative regulation of female receptivity; transcription, DNA-dependent; regulation of catalytic activity; negative regulation of catalytic activity; response to amphetamine; visual learning; negative regulation of protein kinase activity; signal transduction

Research Articles on PPP1R1B

Similar Products

Product Notes

The PPP1R1B ppp1r1b (Catalog #AAA1367039) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-168aa; Full Length of Isoform 2. The amino acid sequence is listed below: MLFRLSEHSS PEEEASPHQR ASGEGHHLKS KRPNPCAYTP PSLKAVQRIA ESHLQSISNL NENQASEEED ELGELRELGY PREEDEEEEE DDEEEEEEED SQAEVLKVIR QSAGQKTTCG QGLEGPWERP PPLDESERDG GSEDQVEDPA LSEPGEEPQR PSPSEPGT. It is sometimes possible for the material contained within the vial of "Protein phosphatase 1 regulatory subunit 1B (PPP1R1B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.