Western Blot (WB)
(WB Suggested Anti-ZNF780A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)
Rabbit anti-Horse, Human ZNF780A Polyclonal Antibody | anti-ZNF780A antibody
ZNF780A antibody - N-terminal region
Gene Names
ZNF780A; ZNF780
Reactivity
Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF780A; Polyclonal Antibody; ZNF780A antibody - N-terminal region; anti-ZNF780A antibody
Host
Rabbit
Reactivity
Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TSRRYPDLELKYGPEKVSPENDTSEVNLPKQVIKQISTTLGIEAFYFRND
Sequence Length
607
Applicable Applications for anti-ZNF780A antibody
Western Blot (WB)
Homology
Horse: 100%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF780A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ZNF780A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-ZNF780A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)
Related Product Information for anti-ZNF780A antibody
This is a rabbit polyclonal antibody against ZNF780A. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ZNF780A belongs to the krueppel C2H2-type zinc-finger protein family. It contains 17 C2H2-type zinc fingers and 1 KRAB domain. ZNF780A may be involved in transcriptional regulation.
Target Description: ZNF780A belongs to the krueppel C2H2-type zinc-finger protein family. It contains 17 C2H2-type zinc fingers and 1 KRAB domain. ZNF780A may be involved in transcriptional regulation.
Product Categories/Family for anti-ZNF780A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70kDa
NCBI Official Full Name
zinc finger protein 780A isoform b
NCBI Official Synonym Full Names
zinc finger protein 780A
NCBI Official Symbol
ZNF780A
NCBI Official Synonym Symbols
ZNF780
NCBI Protein Information
zinc finger protein 780A
UniProt Protein Name
Zinc finger protein 780A
Protein Family
UniProt Gene Name
ZNF780A
UniProt Entry Name
Z780A_HUMAN
Uniprot Description
Function: May be involved in transcriptional regulation
By similarity.
Subcellular location: Nucleus
Probable.
Sequence similarities: Belongs to the krueppel C2H2-type zinc-finger protein family.Contains 17 C2H2-type zinc fingers.Contains 1 KRAB domain.
Sequence caution: The sequence AAC34327.1 differs from that shown. Reason: Erroneous gene model prediction.
Similar Products
Product Notes
The ZNF780A znf780a (Catalog #AAA3209911) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF780A antibody - N-terminal region reacts with Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF780A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZNF780A znf780a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TSRRYPDLEL KYGPEKVSPE NDTSEVNLPK QVIKQISTTL GIEAFYFRND. It is sometimes possible for the material contained within the vial of "ZNF780A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
