Mouse anti-Human ZNF643 Polyclonal Antibody | anti-ZFP69B antibody

ZNF643 (Zinc Finger Protein 643, ZFP69B, Zinc Finger Protein ZFP69B, ZKSCAN23B, ZSCAN54B)

Cat. Num. AAA641192

• Gene Names: ZFP69B; ZNF643; ZSCAN54B; ZKSCAN23B; RP11-656D10.1
• Reactivity: Human
• Applications: Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ZNF643; Polyclonal Antibody; ZNF643 (Zinc Finger Protein 643; ZFP69B; Zinc Finger Protein ZFP69B; ZKSCAN23B; ZSCAN54B); Anti -ZNF643 (Zinc Finger Protein 643; anti-ZFP69B antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ZNF643.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MLENYGNLVSVGCQLSKPGVISQLEKGEEPWLMERDISGVPSSDLKSKTKTKESALQNDISWEELHCGLMMERFTKGSSMYSTLGRISKCNKLESQQENQRMGKGQIPLMCKKTFTQERGQESNRFEKRINVKSEVMPGPIGLPRKRDRKYDTPGKRSRYNIDLVNHSRSYTKMKTFECNICEKIFKQLIHLTEHMRIHTGEKPFRCKECGKAFSQSSSLIPHQRIHTGEKPYECKECGKTFRHPSSLTQHVRIHTGEKPYECRVCEKAFSQSIGLIQHLRTHVREKPFTCKDCGKAFFQIRHLRQHEIIHTGVKPYICNVCSKTFSHSTYLTQHQRTHTGERPYKCKECGKAFSQRIHLSIHQRVHTGVKPYECSHCGKAFRHDSSFAKHQRIHTGEKPYDCNECGKAFSCSSSLIRHCKTHLRNTFSNVV

• Applicable Applications for anti-ZFP69B antibody: Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Full length human ZNF643, aa1-432 (NP_075558.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ZNF643 expression in transfected 293T cell line by ZNF643 polyclonal antibody. Lane 1: ZNF643 transfected lysate (47.52kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to ZNF643 on HeLa cell. [antibody concentration 10ug/ml].)

Product Categories/Family for anti-ZFP69B antibody

Antibodies; Abs to Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 296317246
• NCBI GeneID: 65243
• NCBI Accession #: NP_075558.2
• NCBI GenBank Nucleotide #: NM_023070.2
• UniProt Accession #: Q9UJL9; Q5QPL4
• Molecular Weight: 61,481 Da
• NCBI Official Full Name: zinc finger protein ZFP69B
• NCBI Official Synonym Full Names: ZFP69 zinc finger protein B
• NCBI Official Symbol: ZFP69B
• NCBI Official Synonym Symbols: ZNF643; ZSCAN54B; ZKSCAN23B; RP11-656D10.1
• NCBI Protein Information: zinc finger protein ZFP69B; zinc finger protein 643; novel zinc finger protein
• UniProt Protein Name: Zinc finger protein ZFP69B
• Protein Family: Zinc finger protein
• UniProt Gene Name: ZFP69B
• UniProt Synonym Gene Names: ZNF643
• UniProt Entry Name: ZF69B_HUMAN

Uniprot Description

ZNF643: May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 1p34.2

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding; transcription factor activity

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent