Immunoprecipitation (IP)
(Immunoprecipitation of ZNF622 transfected lysate using ZNF622 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with ZNF622 mouse polyclonal antibody.)
Rabbit anti-Human ZNF622 Polyclonal Antibody | anti-ZNF622 antibody
ZNF622 (Zinc Finger Protein 622, Zinc Finger-like Protein 9, ZPR9)
Reactivity
Human
Applications
Immunoprecipitation
Purity
SerumSerum
Synonyms
ZNF622; Polyclonal Antibody; ZNF622 (Zinc Finger Protein 622; Zinc Finger-like Protein 9; ZPR9); Anti -ZNF622 (Zinc Finger Protein 622; anti-ZNF622 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ZNF622.
Purity/Purification
Serum
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEEESKGSATYCTVCSKKFASFNAYENHLKSRRHVELEKKAVQAVNRKVEMMNEKNLEKGLGVDSVDKDAMNAAIQQAIKAQPSMSPKKAPPAPAKEARNVVAVGTGGRGTHDRDPSEKPPRLQWFEQQAKKLAKQQEEDSEEEEEDLDGDDWEDIDSDEELECEDTEAMDDVVEQDAEEEEAEEGPPLGAIPITDCLFCSHHSSSLMKNVAHMTKDHSFFIPDIEYLSDIKGLIKYLGEKVGVGKICLWCNEKGKSFYSTEAVQAHMNDKSHCKLFTDGDAALEFADFYDFRSSYPDHKEGEDPNKAEELPSEKNLEYDDETMELILPSGARVGHRSLMRYYKQRFGLSRAVAVAKNRKAVGRVLQQYRALGWTGSTGAALMRERDMQYVQRMKSKWMLKTGMKNNATKQMHFRVQVRF
Applicable Applications for anti-ZNF622 antibody
Immunoprecipitation (IP)
Application Notes
Suitable for use in Immunoprecipitation.
Immunogen
Full length human ZNF622, aa1-477 (NP_219482.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunoprecipitation (IP)
(Immunoprecipitation of ZNF622 transfected lysate using ZNF622 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with ZNF622 mouse polyclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of ZNF622 transfected lysate using ZNF622 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with ZNF622 mouse polyclonal antibody.)
Product Categories/Family for anti-ZNF622 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
zinc finger protein 622
NCBI Official Synonym Full Names
zinc finger protein 622
NCBI Official Symbol
ZNF622
NCBI Protein Information
zinc finger protein 622
Protein Family
Similar Products
Product Notes
The ZNF622 (Catalog #AAA641437) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF622 (Zinc Finger Protein 622, Zinc Finger-like Protein 9, ZPR9) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF622 can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP). Suitable for use in Immunoprecipitation. Researchers should empirically determine the suitability of the ZNF622 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MATYTCITCR VAFRDADMQR AHYKTDWHRY NLRRKVASMA PVTAEGFQER VRAQRAVAEE ESKGSATYCT VCSKKFASFN AYENHLKSRR HVELEKKAVQ AVNRKVEMMN EKNLEKGLGV DSVDKDAMNA AIQQAIKAQP SMSPKKAPPA PAKEARNVVA VGTGGRGTHD RDPSEKPPRL QWFEQQAKKL AKQQEEDSEE EEEDLDGDDW EDIDSDEELE CEDTEAMDDV VEQDAEEEEA EEGPPLGAIP ITDCLFCSHH SSSLMKNVAH MTKDHSFFIP DIEYLSDIKG LIKYLGEKVG VGKICLWCNE KGKSFYSTEA VQAHMNDKSH CKLFTDGDAA LEFADFYDFR SSYPDHKEGE DPNKAEELPS EKNLEYDDET MELILPSGAR VGHRSLMRYY KQRFGLSRAV AVAKNRKAVG RVLQQYRALG WTGSTGAALM RERDMQYVQR MKSKWMLKTG MKNNATKQMH FRVQVRF. It is sometimes possible for the material contained within the vial of "ZNF622, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
