Mouse anti-Human ZNF557 Polyclonal Antibody | anti-ZNF557 antibody

ZNF557 (Zinc Finger Protein 557)

Cat. Num. AAA6010235

• Reactivity: Human
• Applications: Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ZNF557; Polyclonal Antibody; ZNF557 (Zinc Finger Protein 557); Anti -ZNF557 (Zinc Finger Protein 557); anti-ZNF557 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ZNF557.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAAVVLPPTAALSSLFPASQREGHTEGGELVNELLKSWLKGLVTFEDVAVEFTQEEWALLDPAQRTLYRDVMLENCRNLASLGNQVDKPRLISQLEQEDKVMTEERGILSGTCPDVENPFKAKGLTPKLHVFRKEQSRNMKMERNHLGATLNECNQCFKVFSTKSSLTRHRKIHTGERPYGCSECGKSYSSRSYLAVHKRIHNGEKPYECNDCGKTFSSRSYLTVHKRIHNGEKPYECSDCGKTFSNSSYLRPHLRIHTGEKPYKCNQCFREFRTQSIFTRHKRVHTGEGHYVCNQCGKAFGTRSSLSSHYSIHTGEYPYECHDCGRTFRRRSNLTQHIRTHTGEKPYTCNECGKSFTNSFSLTIHRRIHNGEKS

• Applicable Applications for anti-ZNF557 antibody: Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Full length human ZNF557, aa1-375 (AAH03020.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ZNF557 expression in transfected 293T cell line by ZNF557 polyclonal antibody. Lane 1: ZNF557 transfected lysate (41.25kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to ZNF557 on HepG2 cell. [antibody concentration 10ug/ml].)

Product Categories/Family for anti-ZNF557 antibody

Antibodies; Abs to Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 113205083
• NCBI GeneID: 79230
• NCBI Accession #: NP_001037853.1
• NCBI GenBank Nucleotide #: NM_001044388.1
• UniProt Accession #: Q8N988; Q6PEJ3; Q9BTZ1
• Molecular Weight: 48,627 Da
• NCBI Official Full Name: zinc finger protein 557 isoform b
• NCBI Official Synonym Full Names: zinc finger protein 557
• NCBI Official Symbol: ZNF557
• NCBI Protein Information: zinc finger protein 557
• UniProt Protein Name: Zinc finger protein 557
• Protein Family: Zinc finger protein
• UniProt Gene Name: ZNF557
• UniProt Entry Name: ZN557_HUMAN

Uniprot Description

ZNF557: May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription regulation; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent