Western Blot (WB)
(WB Suggested Anti-ZNF431 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Spleen)
Rabbit anti-Human ZNF431 Polyclonal Antibody | anti-ZNF431 antibody
ZNF431 antibody - middle region
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF431; Polyclonal Antibody; ZNF431 antibody - middle region; anti-ZNF431 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TLTKHRKIHTRQKPYNCEECDNTFNQSSNLIKQNNSYWRETLQMSRMWES
Sequence Length
576
Applicable Applications for anti-ZNF431 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZNF431
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ZNF431 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Spleen)
Western Blot (WB)
(WB Suggested Anti-ZNF431 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Spleen)
Related Product Information for anti-ZNF431 antibody
This is a rabbit polyclonal antibody against ZNF431. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ZNF431 may be involved in transcriptional regulation.
Target Description: ZNF431 may be involved in transcriptional regulation.
Product Categories/Family for anti-ZNF431 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
zinc finger protein 431 isoform 2
NCBI Official Synonym Full Names
zinc finger protein 431
NCBI Official Symbol
ZNF431
NCBI Protein Information
zinc finger protein 431
UniProt Protein Name
Zinc finger protein 431
Protein Family
UniProt Gene Name
ZNF431
UniProt Synonym Gene Names
KIAA1969
UniProt Entry Name
ZN431_HUMAN
NCBI Description
This gene encodes a member of the Krueppel C2H2-type zinc-finger family of proteins. The encoded protein may negatively regulate transcription of target genes, including the hedgehog signaling pathway receptor patched 1, by interacting with histone deacetylases. Mutations in this gene may be associated with non-syndromic facial clefting in human patients. [provided by RefSeq, Jul 2016]
Similar Products
Product Notes
The ZNF431 znf431 (Catalog #AAA3204847) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF431 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF431 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZNF431 znf431 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TLTKHRKIHT RQKPYNCEEC DNTFNQSSNL IKQNNSYWRE TLQMSRMWES. It is sometimes possible for the material contained within the vial of "ZNF431, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
