Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Skin)

Rabbit ZNF385 Polyclonal Antibody | anti-ZNF385A antibody

ZNF385 antibody - C-terminal region

Gene Names
ZNF385A; HZF; RZF; ZFP385; ZNF385
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ZNF385; Polyclonal Antibody; ZNF385 antibody - C-terminal region; anti-ZNF385A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LKQHISSRRHRDGVAGKPNPLLSRHKKSRGAGELAGTLTFSKELPKSLAG
Sequence Length
366
Applicable Applications for anti-ZNF385A antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF385
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Skin)

Immunohistochemistry (IHC) (Human Skin)

Western Blot (WB)

(WB Suggested Anti-ZNF385 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: K562 cell lysate)

Western Blot (WB) (WB Suggested Anti-ZNF385 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: K562 cell lysate)
Related Product Information for anti-ZNF385A antibody
This is a rabbit polyclonal antibody against ZNF385. It was validated on Western Blot and immunohistochemistry

Target Description: Results suggest that RZF is a shuttling regulatory protein expressed in photoreceptors of the human retina that may be involved in mRNA or protein regulation of photoreceptor-specific genes and therefore have role in retinal disease mechanisms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
zinc finger protein 385A isoform c
NCBI Official Synonym Full Names
zinc finger protein 385A
NCBI Official Symbol
ZNF385A
NCBI Official Synonym Symbols
HZF; RZF; ZFP385; ZNF385
NCBI Protein Information
zinc finger protein 385A
UniProt Protein Name
Zinc finger protein 385A
Protein Family
UniProt Gene Name
ZNF385A
UniProt Synonym Gene Names
HZF; RZF; ZNF385
UniProt Entry Name
Z385A_HUMAN

NCBI Description

Zinc finger proteins, such as ZNF385A, are regulatory proteins that act as transcription factors, bind single- or double-stranded RNA, or interact with other proteins (Sharma et al., 2004 [PubMed 15527981]).[supplied by OMIM, Oct 2008]

Research Articles on ZNF385A

Similar Products

Product Notes

The ZNF385A znf385a (Catalog #AAA3200598) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF385 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF385 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ZNF385A znf385a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LKQHISSRRH RDGVAGKPNP LLSRHKKSRG AGELAGTLTF SKELPKSLAG. It is sometimes possible for the material contained within the vial of "ZNF385, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.