Rabbit anti-Human ZNF350 Polyclonal Antibody | anti-ZNF350 antibody

ZNF350 (Zinc Finger Protein 350, KRAB Zinc Finger Protein ZFQR, ZFQR, Zinc Finger and BRCA1-interacting Protein with a KRAB Domain 1, Zinc Finger Protein ZBRK1, ZBRK1) (PE)

Cat. Num. AAA6399194

• Gene Names: ZNF350; ZFQR; ZBRK1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ZNF350; Polyclonal Antibody; ZNF350 (Zinc Finger Protein 350; KRAB Zinc Finger Protein ZFQR; ZFQR; Zinc Finger and BRCA1-interacting Protein with a KRAB Domain 1; Zinc Finger Protein ZBRK1; ZBRK1) (PE); anti-ZNF350 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ZNF350.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-ZNF350 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human ZNF350, aa1-532 (NP_067645.3).
• Immunogen Sequence: MIQAQESITLEDVAVDFTWEEWQLLGAAQKDLYRDVMLENYSNLVAVGYQASKPDALFKLEQGEQLWTIEDGIHSGACSDIWKVDHVLERLQSESLVNRRKPCHEHDAFENIVHCSKSQFLLGQNHDIFDLRGKSLKSNLTLVNQSKGYEIKNSVEFTGNGDSFLHANHERLHTAIKFPASQKLISTKSQFISPKHQKTRKLEKHHVCSECGKAFIKKSWLTDHQVMHTGEKPHRCSLCEKAFSRKFMLTEHQRTHTGEKPYECPECGKAFLKKSRLNIHQKTHTGEKPYICSECGKGFIQKGNLIVHQRIHTGEKPYICNECGKGFIQKTCLIAHQRFHTGKTPFVCSECGKSCSQKSGLIKHQRIHTGEKPFECSECGKAFSTKQKLIVHQRTHTGERPYGCNECGKAFAYMSCLVKHKRIHTREKQEAAKVENPPAERHSSLHTSDVMQEKNSANGATTQVPSVAPQTSLNISGLLANRNVVLVGQPVVRCAASGDNRGFAQDRNLVNAVNVVVPSVINYVLFYVTENP
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ZNF350 expression in transfected 293T cell line by ZNF350 polyclonal antibody. Lane 1: ZNF350 transfected lysate (6kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-ZNF350 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 59710107
• NCBI GeneID: 59348
• NCBI Accession #: NP_067645.3
• NCBI GenBank Nucleotide #: NM_021632.3
• UniProt Accession #: Q9GZX5; Q96G73; Q9HAQ4
• Molecular Weight: 60,011 Da
• NCBI Official Full Name: zinc finger protein 350
• NCBI Official Synonym Full Names: zinc finger protein 350
• NCBI Official Symbol: ZNF350
• NCBI Official Synonym Symbols: ZFQR; ZBRK1
• NCBI Protein Information: zinc finger protein 350; zinc finger protein ZBRK1; zinc-finger protein ZBRK1; KRAB zinc finger protein ZFQR; zinc finger and BRCA1-interacting protein with a KRAB domain 1
• UniProt Protein Name: Zinc finger protein 350
• Protein Family: Zinc finger protein
• UniProt Gene Name: ZNF350
• UniProt Synonym Gene Names: ZBRK1
• UniProt Entry Name: ZN350_HUMAN

Uniprot Description

ZNF350: Transcriptional repressor. Binds to a specific sequence, 5'-GGGxxxCAGxxxTTT-3', within GADD45 intron 3. Belongs to the krueppel C2H2-type zinc-finger protein family.

Protein type: Transcription factor; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 19q13.41

Cellular Component: nucleoplasm; nuclear matrix; transcriptional repressor complex; nucleus

Molecular Function: protein binding; DNA binding; metal ion binding

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent