Western Blot (WB)
(WB Suggested Anti-ZNF312 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)
Rabbit ZNF312 Polyclonal Antibody | anti-FEZF2 antibody
ZNF312 antibody - N-terminal region
Gene Names
FEZF2; FEZ; TOF; FEZL; FKSG36; ZFP312; ZNF312
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
ZNF312; Polyclonal Antibody; ZNF312 antibody - N-terminal region; anti-FEZF2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MASSASLETMVPPACPRAGASPATSKTLAFSIERIMAKTSEPRAPFEPRP
Sequence Length
459
Applicable Applications for anti-FEZF2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF312
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ZNF312 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-ZNF312 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-FEZF2 antibody
This is a rabbit polyclonal antibody against ZNF312. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ZNF312 is a candidate transcription factor
Target Description: ZNF312 is a candidate transcription factor
Product Categories/Family for anti-FEZF2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
fez family zinc finger protein 2
NCBI Official Synonym Full Names
FEZ family zinc finger 2
NCBI Official Symbol
FEZF2
NCBI Official Synonym Symbols
FEZ; TOF; FEZL; FKSG36; ZFP312; ZNF312
NCBI Protein Information
fez family zinc finger protein 2
UniProt Protein Name
Fez family zinc finger protein 2
Protein Family
UniProt Gene Name
FEZF2
UniProt Synonym Gene Names
FEZL; ZNF312
UniProt Entry Name
FEZF2_HUMAN
Uniprot Description
Function: Transcription repressor. Required for the specification of corticospinal motor neurons and other subcerebral projection neurons. May play a role in layer and neuronal subtype-specific patterning of subcortical projections and axonal fasciculation. Controls the development of dendritic arborization and spines of large layer V pyramidal neurons. May be involved in innate immunity
By similarity.
Subcellular location: Nucleus
By similarity.
Sequence similarities: Belongs to the krueppel C2H2-type zinc-finger protein family.Contains 6 C2H2-type zinc fingers.
Research Articles on FEZF2
Similar Products
Product Notes
The FEZF2 fezf2 (Catalog #AAA3201352) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF312 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF312 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FEZF2 fezf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MASSASLETM VPPACPRAGA SPATSKTLAF SIERIMAKTS EPRAPFEPRP. It is sometimes possible for the material contained within the vial of "ZNF312, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
