Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ZNF280A Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

Rabbit ZNF280A Polyclonal Antibody | anti-ZNF280A antibody

ZNF280A antibody - C-terminal region

Gene Names
ZNF280A; SUHW1; ZNF280; ZNF636; 3'OY11.1
Reactivity
Guinea Pig, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF280A; Polyclonal Antibody; ZNF280A antibody - C-terminal region; anti-ZNF280A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WRHSRRRVLQCSKCRLQFLTLKEEIEHKTKDHQTFKKPEQLQGFPRETKV
Sequence Length
542
Applicable Applications for anti-ZNF280A antibody
Western Blot (WB)
Homology
Guinea Pig: 86%; Human: 100%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF280A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ZNF280A Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-ZNF280A Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)
Related Product Information for anti-ZNF280A antibody
This is a rabbit polyclonal antibody against ZNF280A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The predicted protein ZNF280A is similar to Drosophila suppressor of hairy wing protein, a leucine zipper protein which represses the function of transcriptional enhancers of the gypsy retrotransposon. ZNF280A may function as a transcription factor.This gene was predicted both by automated computational analysis and by similarity to a Drosophila gene and to predicted genes in other species (sheep, chimp, dog, cow). The predicted protein of this gene is similar to Drosophila suppressor of hairy wing protein, a leucine zipper protein which represses the function of transcriptional enhancers of the gypsy retrotransposon.
Product Categories/Family for anti-ZNF280A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
zinc finger protein 280A
NCBI Official Synonym Full Names
zinc finger protein 280A
NCBI Official Symbol
ZNF280A
NCBI Official Synonym Symbols
SUHW1; ZNF280; ZNF636; 3'OY11.1
NCBI Protein Information
zinc finger protein 280A
UniProt Protein Name
Zinc finger protein 280A
Protein Family
UniProt Gene Name
ZNF280A
UniProt Synonym Gene Names
SUHW1; ZNF280; ZNF636
UniProt Entry Name
Z280A_HUMAN

NCBI Description

This gene encodes a zinc finger protein. The encoded protein contains 4 C2H2-type zinc fingers, which are commonly found in transcription factors. A variety of functions may be performed by this type of zinc finger protein, including the binding of DNA or RNA. [provided by RefSeq, Apr 2014]

Uniprot Description

Function: May function as a transcription factor.

Subcellular location: Nucleus

Potential.

Sequence similarities: Contains 4 C2H2-type zinc fingers.

Similar Products

Product Notes

The ZNF280A znf280a (Catalog #AAA3210078) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF280A antibody - C-terminal region reacts with Guinea Pig, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF280A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZNF280A znf280a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WRHSRRRVLQ CSKCRLQFLT LKEEIEHKTK DHQTFKKPEQ LQGFPRETKV. It is sometimes possible for the material contained within the vial of "ZNF280A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.