Western Blot (WB)
(Western Blot analysis of ZNF277 expression in transfected 293T cell line by ZNF277 polyclonal antibody. Lane 1: ZNF277 transfected lysate (48.18kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human ZNF277 Polyclonal Antibody | anti-ZNF277 antibody
ZNF277 (Zinc Finger Protein 277, ZNF277P, Nuclear Receptor-interacting Factor 4, NRIF4)
Gene Names
ZNF277; NRIF4; ZNF277P
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
ZNF277; Polyclonal Antibody; ZNF277 (Zinc Finger Protein 277; ZNF277P; Nuclear Receptor-interacting Factor 4; NRIF4); Anti -ZNF277 (Zinc Finger Protein 277; anti-ZNF277 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ZNF277.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MQEDRDGSCSTVGGVGYGDSKDCILEPLSLPESPGGTTTLEGSPSVPCIFCEEHFPVAEQDKLLKHMIIEHKIVIADVKLVADFQRYILYWRKRFTEQPITDFCSVIRINSTAPFEEQENYFLLCDVLPEDRILREELQKQRLREILEQQQQERNDTNFHGVCMFCNEEFLGNRSVILNHMAREHAFNIGLPDNIVNCNEFLCTLQKKLDNLQCLYCEKTFRDKNTLKDHMRKKQHRKINPKNREYDRFYVINYLELGKSWEEVQLEDDRELLDHQEDDWSDWEEHPASAVCLFCEKQAETIEKLYVHMEDAHEFDLLKIKSELGLNFYQQVKLVNFIRRQVHQCRCYGCHVKFKSKADLRTHMEETKHTSLLPDRKTWDQLEYYFPTYENDTLLCTLSDSESDLTAQEQNENVPIISEDTSKLYALKQSSILNQLLL
Applicable Applications for anti-ZNF277 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human ZNF277, aa1-438 (ENSP00000355043).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of ZNF277 expression in transfected 293T cell line by ZNF277 polyclonal antibody. Lane 1: ZNF277 transfected lysate (48.18kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of ZNF277 expression in transfected 293T cell line by ZNF277 polyclonal antibody. Lane 1: ZNF277 transfected lysate (48.18kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-ZNF277 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52,788 Da
NCBI Official Full Name
zinc finger protein 277
NCBI Official Synonym Full Names
zinc finger protein 277
NCBI Official Symbol
ZNF277
NCBI Official Synonym Symbols
NRIF4; ZNF277P
NCBI Protein Information
zinc finger protein 277; zinc finger protein 277 pseudogene; zinc finger protein (C2H2 type) 277; nuclear receptor-interacting factor 4
UniProt Protein Name
Zinc finger protein 277
Protein Family
UniProt Gene Name
ZNF277
UniProt Synonym Gene Names
NRIF4; ZNF277P
UniProt Entry Name
ZN277_HUMAN
Uniprot Description
Function: May be involved in transcriptional regulation.
Subcellular location: Nucleus
Potential.
Sequence similarities: Belongs to the ZNF277 family.Contains 2 C2H2-type zinc fingers.
Sequence caution: The sequence AAF85941.1 differs from that shown. Reason: Erroneous initiation. The sequence AAS07413.1 differs from that shown. Reason: Erroneous initiation.
Similar Products
Product Notes
The ZNF277 znf277 (Catalog #AAA648822) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZNF277 (Zinc Finger Protein 277, ZNF277P, Nuclear Receptor-interacting Factor 4, NRIF4) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF277 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the ZNF277 znf277 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQEDRDGSCS TVGGVGYGDS KDCILEPLSL PESPGGTTTL EGSPSVPCIF CEEHFPVAEQ DKLLKHMIIE HKIVIADVKL VADFQRYILY WRKRFTEQPI TDFCSVIRIN STAPFEEQEN YFLLCDVLPE DRILREELQK QRLREILEQQ QQERNDTNFH GVCMFCNEEF LGNRSVILNH MAREHAFNIG LPDNIVNCNE FLCTLQKKLD NLQCLYCEKT FRDKNTLKDH MRKKQHRKIN PKNREYDRFY VINYLELGKS WEEVQLEDDR ELLDHQEDDW SDWEEHPASA VCLFCEKQAE TIEKLYVHME DAHEFDLLKI KSELGLNFYQ QVKLVNFIRR QVHQCRCYGC HVKFKSKADL RTHMEETKHT SLLPDRKTWD QLEYYFPTYE NDTLLCTLSD SESDLTAQEQ NENVPIISED TSKLYALKQS SILNQLLL. It is sometimes possible for the material contained within the vial of "ZNF277, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
