Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ZNF253 MaxPab rabbit polyclonal antibody. Western Blot analysis of ZNF253 expression in Jurkat.)

Rabbit anti-Human ZNF253 Polyclonal Antibody | anti-ZNF253 antibody

ZNF253 (Zinc Finger Protein 253, BMZF-1, BMZF1, FLJ90391, ZNF411) (Biotin)

Gene Names
ZNF253; BMZF1; BMZF-1; ZNF411
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
ZNF253; Polyclonal Antibody; ZNF253 (Zinc Finger Protein 253; BMZF-1; BMZF1; FLJ90391; ZNF411) (Biotin); Zinc Finger Protein 253; ZNF411; anti-ZNF253 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ZNF253.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ZNF253 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ZNF253 (NP_066385.2, 1aa-499aa) full-length human protein.
Immunogen Sequence
MGPLQFRDVAIEFSLEEWHCLDTAQRNLYRDVMLENYRNLVFLGIVVSKPDLVTCLEQGKKPLTMERHEMIAKPPVMSSHFAQDLWPENIQNSFQIGMLRRYEECRHDNLQLKKGCKSVGEHKVHKGGYNGLNQCLTTTQKEIFQCDKYGKVFHKFSNSNTYKTRHTGINLFKCIICGKAFKRSSTLTTHKKIHTGEKPYRCEECGKAFNQSANLTTHKRIHTGEKPYRCEECGKAFKQSSNLTTHKKIHTGEKPYKCEECGKAFNRSTDLTTHKIVHTGEKPYKCEECGKAFKHPSHVTTHKKIHTRGKPYNCEECGKSFKHCSNLTIHKRIHTGEKPYKCEECGKAFHLSSHLTTHKILHTGEKPYRCRECGKAFNHSTTLFSHEKIHTGEKPYKCDECGKTFTWPSILSKHKRTHTGEKPYKCEECGKSFTASSTLTTHKRIHTGEKPYKCEECGKAFNWSSDLNKHKKIHIERKPYIVKNVTDLLNVPPLLISIR
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ZNF253 MaxPab rabbit polyclonal antibody. Western Blot analysis of ZNF253 expression in Jurkat.)

Western Blot (WB) (ZNF253 MaxPab rabbit polyclonal antibody. Western Blot analysis of ZNF253 expression in Jurkat.)
Related Product Information for anti-ZNF253 antibody
Rabbit polyclonal antibody raised against a full-length human ZNF253 protein.
Product Categories/Family for anti-ZNF253 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57,602 Da
NCBI Official Full Name
zinc finger protein 253
NCBI Official Synonym Full Names
zinc finger protein 253
NCBI Official Symbol
ZNF253
NCBI Official Synonym Symbols
BMZF1; BMZF-1; ZNF411
NCBI Protein Information
zinc finger protein 253; DNA-binding protein; zinc finger protein 411; bone marrow zinc finger 1
UniProt Protein Name
Zinc finger protein 253
Protein Family
UniProt Gene Name
ZNF253
UniProt Synonym Gene Names
BMZF1; ZNF411; BMZF-1
UniProt Entry Name
ZN253_HUMAN

Similar Products

Product Notes

The ZNF253 znf253 (Catalog #AAA6451852) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF253 (Zinc Finger Protein 253, BMZF-1, BMZF1, FLJ90391, ZNF411) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF253 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZNF253 znf253 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZNF253, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.