Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ZNF141 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Rabbit ZNF141 Polyclonal Antibody | anti-ZNF141 antibody

ZNF141 antibody - middle region

Gene Names
ZNF141; D4S90; pHZ-44
Reactivity
Human, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF141; Polyclonal Antibody; ZNF141 antibody - middle region; anti-ZNF141 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KCKECDKAFKQFSLLSQHKKIHTVDKPYKCKDCDKAFKRFSHLNKHKKIH
Sequence Length
474
Applicable Applications for anti-ZNF141 antibody
Western Blot (WB)
Homology
Human: 100%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZNF141
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ZNF141 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-ZNF141 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)
Related Product Information for anti-ZNF141 antibody
This is a rabbit polyclonal antibody against ZNF141. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Zinc finger encoding genes would be good candidates for being involved in the multiple developmental defects associated with chromosomal aneusomy--because of their role as transcriptional regulators, their abundance in the genome and their known association with specific developmental disorders. A zinc finger encoding cDNA (ZNF141) of the C2-H2/KRAB subfamily has been mapped to the 4p- (Wolf-Hirschhorn) syndrome (WHS) chromosome region. ZNF141 was expressed ubiquitously at low levels in the analysed tissue. The identification of a candidate gene for a chromosomal aneusomy syndrome belonging to a class of evolutionary conserved genes will provide options for studying its normal and abnormal expression during mammalian embryogenesis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
zinc finger protein 141 isoform 1
NCBI Official Synonym Full Names
zinc finger protein 141
NCBI Official Symbol
ZNF141
NCBI Official Synonym Symbols
D4S90; pHZ-44
NCBI Protein Information
zinc finger protein 141
UniProt Protein Name
Zinc finger protein 141
Protein Family
UniProt Gene Name
ZNF141
UniProt Synonym Gene Names
D4S90
UniProt Entry Name
ZN141_HUMAN

NCBI Description

The protein encoded by this gene is a zinc finger protein that may be a tumor suppressor. Defects in this gene have been associated with autosomal recessive postaxial polydactyly type A. [provided by RefSeq, Jan 2017]

Research Articles on ZNF141

Similar Products

Product Notes

The ZNF141 znf141 (Catalog #AAA3204027) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF141 antibody - middle region reacts with Human, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF141 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZNF141 znf141 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KCKECDKAFK QFSLLSQHKK IHTVDKPYKC KDCDKAFKRF SHLNKHKKIH. It is sometimes possible for the material contained within the vial of "ZNF141, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.