Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ZNF14 antibody (MBS839253) used at 0.5 ug/ml to detect target protein.)

Rabbit anti-Human, Mouse ZNF14 Polyclonal Antibody | anti-ZNF14 antibody

ZNF14 antibody

Gene Names
ZNF14; KOX6; GIOT-4
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
ZNF14; Polyclonal Antibody; ZNF14 antibody; Polyclonal ZNF14; Anti-ZNF14; ZNF-14; ZNF 14; KOX6; GIOT-4; Zinc Finger Protein 14; anti-ZNF14 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Specificity
ZNF14 antibody was raised against the N terminal of ZNF14
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZNF14 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
642
Applicable Applications for anti-ZNF14 antibody
Western Blot (WB)
Application Notes
WB: 0.5 ug/ml
Biological Significance
ZNF14 contains a zinc finger and a Kruppel-associated box (KRAB) domain. KRAB domain is known to be involved in the transcriptional repression of a number of zinc finger proteins.
Cross-Reactivity
Human,Mouse
Immunogen
ZNF14 antibody was raised using the N terminal of ZNF14 corresponding to a region with amino acids IYYQPFQRHERTHAGQKPYECKQCGKTFIYYQSFQKHAHTGKKPYECKQC
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(ZNF14 antibody (MBS839253) used at 0.5 ug/ml to detect target protein.)

Western Blot (WB) (ZNF14 antibody (MBS839253) used at 0.5 ug/ml to detect target protein.)
Related Product Information for anti-ZNF14 antibody
Rabbit polyclonal ZNF14 antibody raised against the N terminal of ZNF14
Product Categories/Family for anti-ZNF14 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
71 kDa (MW of target protein)
NCBI Official Full Name
zinc finger protein 14
NCBI Official Synonym Full Names
zinc finger protein 14
NCBI Official Symbol
ZNF14
NCBI Official Synonym Symbols
KOX6; GIOT-4
NCBI Protein Information
zinc finger protein 14
UniProt Protein Name
Zinc finger protein 14
Protein Family
UniProt Gene Name
ZNF14
UniProt Synonym Gene Names
GIOT4; KOX6; GIOT-4
UniProt Entry Name
ZNF14_HUMAN

NCBI Description

The protein encoded by this gene contains a zinc finger and a Kruppel-associated box (KRAB) domain. KRAB domain is known to be involved in the transcriptional repression of a number of zinc finger proteins. [provided by RefSeq, Jul 2008]

Uniprot Description

ZNF14: May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 19p13.11

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding; transcription factor activity

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent

Similar Products

Product Notes

The ZNF14 znf14 (Catalog #AAA839253) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF14 antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.5 ug/ml. Researchers should empirically determine the suitability of the ZNF14 znf14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZNF14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.