Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Heart )

Rabbit ZFP67 Polyclonal Antibody | anti-ZBTB7B antibody

ZFP67 antibody - middle region

Gene Names
ZBTB7B; CKROX; THPOK; ZFP67; ZBTB15; ZFP-67; c-KROX; hcKROX; ZNF857B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
ZFP67; Polyclonal Antibody; ZFP67 antibody - middle region; anti-ZBTB7B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPVCHKIIHGAGKLP
Sequence Length
539
Applicable Applications for anti-ZBTB7B antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZFP67
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Heart )

Immunohistochemistry (IHC) (Human Heart )

Immunohistochemistry (IHC)

(Human Lung )

Immunohistochemistry (IHC) (Human Lung )

Western Blot (WB)

(Host: RabbitTarget Name: ZFP67Sample Type: HepG2Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1.25ug/mLPeptide Concentration: 1.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%)

Western Blot (WB) (Host: RabbitTarget Name: ZFP67Sample Type: HepG2Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1.25ug/mLPeptide Concentration: 1.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%)

Western Blot (WB)

(Host: RabbitTarget Name: ZFP67Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ZFP67Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-ZFP67 Antibody Titration: 1.0-2.0ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-ZFP67 Antibody Titration: 1.0-2.0ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-ZBTB7B antibody
This is a rabbit polyclonal antibody against ZFP67. It was validated on Western Blot and immunohistochemistry

Target Description: ZFP67 is an early growth response gene that encodes a zinc finger-containing transcription factor that binds to the promoter regions of type I collagen genes and has a role in development.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
Zinc finger and BTB domain-containing protein 7B
NCBI Official Synonym Full Names
zinc finger and BTB domain containing 7B
NCBI Official Symbol
ZBTB7B
NCBI Official Synonym Symbols
CKROX; THPOK; ZFP67; ZBTB15; ZFP-67; c-KROX; hcKROX; ZNF857B
NCBI Protein Information
zinc finger and BTB domain-containing protein 7B
UniProt Protein Name
Zinc finger and BTB domain-containing protein 7B
UniProt Gene Name
ZBTB7B
UniProt Synonym Gene Names
ZBTB15; ZFP67; ZNF857B; hcKrox; Zfp-67
UniProt Entry Name
ZBT7B_HUMAN

NCBI Description

This gene encodes a zinc finger-containing transcription factor that acts as a key regulator of lineage commitment of immature T-cell precursors. It is necessary and sufficient for commitment of CD4 lineage, while its absence causes CD8 commitment. It also functions as a transcriptional repressor of type I collagen genes. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

ZBTB7B: Transcription regulator that acts as a key regulator of lineage commitment of immature T-cell precursors. Necessary and sufficient for commitment of CD4 lineage, while its absence causes CD8 commitment. Development of immature T-cell precursors (thymocytes) to either the CD4 helper or CD8 killer T-cell lineages correlates precisely with their T-cell receptor specificity for major histocompatibility complex class II or class I molecules, respectively. Transcriptional repressor of the collagen COL1A1 and COL1A2 genes. May also function as a repressor of fibronectin and possibly other extracellular matrix genes.

Protein type: C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: nucleoplasm; nucleus

Molecular Function: DNA binding; metal ion binding

Biological Process: transcription from RNA polymerase II promoter; regulation of transcription, DNA-dependent; multicellular organismal development; ectoderm development; cell differentiation

Research Articles on ZBTB7B

Similar Products

Product Notes

The ZBTB7B zbtb7b (Catalog #AAA3201137) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZFP67 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZFP67 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ZBTB7B zbtb7b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DLMAYLSSLH QDNLAPGLDS QDKLVRKRRS QMPQECPVCH KIIHGAGKLP. It is sometimes possible for the material contained within the vial of "ZFP67, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.