Western Blot (WB)
(Western blot analysis of extracts of mouse eye, using ZFAND5 Antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)
Rabbit anti-Mouse ZFAND5 Polyclonal Antibody | anti-ZFAND5 antibody
ZFAND5 Polyclonal Antibody
Gene Names
ZFAND5; ZA20D2; ZNF216; ZFAND5A
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
ZFAND5; Polyclonal Antibody; ZFAND5 Polyclonal Antibody; ZA20D2; ZFAND5A; ZNF216; anti-ZFAND5 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
RQQNSGRMSPMGTASGSNSPTSDSASVQRADTSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSEEKAPELPKPK
Sequence Length
213
Applicable Applications for anti-ZFAND5 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:1000
Immunogen
Recombinant protein of human ZFAND5
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm
Positive Samples
Mouse eye
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of mouse eye, using ZFAND5 Antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of mouse eye, using ZFAND5 Antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)
Product Categories/Family for anti-ZFAND5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 23kDa
Observed: 23kDa
Observed: 23kDa
NCBI Official Full Name
AN1-type zinc finger protein 5
NCBI Official Synonym Full Names
zinc finger AN1-type containing 5
NCBI Official Symbol
ZFAND5
NCBI Official Synonym Symbols
ZA20D2; ZNF216; ZFAND5A
NCBI Protein Information
AN1-type zinc finger protein 5
UniProt Protein Name
AN1-type zinc finger protein 5
Protein Family
UniProt Gene Name
ZFAND5
UniProt Synonym Gene Names
ZA20D2; ZNF216
Uniprot Description
Involved in protein degradation via the ubiquitin-proteasome system. May act by anchoring ubiquitinated proteins to the proteasome. Plays a role in ubiquitin-mediated protein degradation during muscle atrophy. Plays a role in the regulation of NF-kappa-B activation and apoptosis. Inhibits NF-kappa-B activation triggered by overexpression of RIPK1 and TRAF6 but not of RELA. Inhibits also tumor necrosis factor (TNF), IL-1 and TLR4-induced NF-kappa-B activation in a dose-dependent manner. Overexpression sensitizes cells to TNF-induced apoptosis. Is a potent inhibitory factor for osteoclast differentiation.
Research Articles on ZFAND5
1. Zfand5 can enhance ARE-containing mRNA stability by competing with tristetraprolin for mRNA binding.
Similar Products
Product Notes
The ZFAND5 zfand5 (Catalog #AAA9133233) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZFAND5 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ZFAND5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:1000. Researchers should empirically determine the suitability of the ZFAND5 zfand5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RQQNSGRMSP MGTASGSNSP TSDSASVQRA DTSLNNCEGA AGSTSEKSRN VPVAALPVTQ QMTEMSISRE DKITTPKTEV SEPVVTQPSP SVSQPSTSQS EEKAPELPKP K. It is sometimes possible for the material contained within the vial of "ZFAND5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
