Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Sample Type : Eye tissue)

Rabbit ZEB1 Polyclonal Antibody | anti-ZEB1 antibody

ZEB1 antibody - N-terminal region

Gene Names
ZEB1; BZP; TCF8; AREB6; FECD6; NIL2A; PPCD3; ZFHEP; ZFHX1A; DELTAEF1
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity Purified
Synonyms
ZEB1; Polyclonal Antibody; ZEB1 antibody - N-terminal region; anti-ZEB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KDDECESDAENEQNHDPNVEEFLQQQDTAVIFPEAPEEDQRQGTPEASGH
Sequence Length
1124
Applicable Applications for anti-ZEB1 antibody
Immunofluorescence (IF), Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZEB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunofluorescence (IF)

(Sample Type : Eye tissue)

Immunofluorescence (IF) (Sample Type : Eye tissue)

Immunofluorescence (IF)

(Sample Type : Eye tissue)

Immunofluorescence (IF) (Sample Type : Eye tissue)

Immunofluorescence (IF)

(Sample Type : Eye tissue)

Immunofluorescence (IF) (Sample Type : Eye tissue)

Western Blot (WB)

(Human Jurkat)

Western Blot (WB) (Human Jurkat)

Western Blot (WB)

(WB Suggested Anti-ZEB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateZEB1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Western Blot (WB) (WB Suggested Anti-ZEB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateZEB1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-ZEB1 antibody
This is a rabbit polyclonal antibody against ZEB1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ZEB1 is a zinc finger transcription factor that represses T-lymphocyte-specific IL2 gene expression by binding to a negative regulatory domain 100 nucleotides 5-prime of the IL2 transcription start site.ZEB1 encodes a zinc finger transcription factor that represses T-lymphocyte-specific IL2 gene (MIM 147680) expression by binding to a negative regulatory domain 100 nucleotides 5-prime of the IL2 transcription start site (Williams et al., 1991 [PubMed 1840704]).[supplied by OMIM].

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
124kDa
NCBI Official Full Name
zinc finger E-box-binding homeobox 1 isoform b
NCBI Official Synonym Full Names
zinc finger E-box binding homeobox 1
NCBI Official Symbol
ZEB1
NCBI Official Synonym Symbols
BZP; TCF8; AREB6; FECD6; NIL2A; PPCD3; ZFHEP; ZFHX1A; DELTAEF1
NCBI Protein Information
zinc finger E-box-binding homeobox 1
UniProt Protein Name
Zinc finger E-box-binding homeobox 1
UniProt Gene Name
ZEB1
UniProt Synonym Gene Names
AREB6; TCF8; TCF-8
UniProt Entry Name
ZEB1_HUMAN

NCBI Description

This gene encodes a zinc finger transcription factor. The encoded protein likely plays a role in transcriptional repression of interleukin 2. Mutations in this gene have been associated with posterior polymorphous corneal dystrophy-3 and late-onset Fuchs endothelial corneal dystrophy. Alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Mar 2010]

Uniprot Description

TCF8: Acts as a transcriptional repressor. Inhibits interleukin-2 (IL-2) gene expression. Enhances or represses the promoter activity of the ATP1A1 gene depending on the quantity of cDNA and on the cell type. Represses E-cadherin promoter and induces an epithelial-mesenchymal transition (EMT) by recruiting SMARCA4/BRG1. Represses BCL6 transcription in the presence of the corepressor CTBP1. Positively regulates neuronal differentiation. Represses RCOR1 transcription activation during neurogenesis. Represses transcription by binding to the E box (5'-CANNTG-3'). Promotes tumorigenicity by repressing stemness-inhibiting microRNAs. Interacts (via N-terminus) with SMARCA4/BRG1. Colocalizes with SMARCA4/BRG1 in E-cadherin- negative cells from established lines, and stroma of normal colon as well as in de-differentiated epithelial cells at the invasion front of colorectal carcinomas. Expressed in heart and skeletal muscle, but not in liver, spleen, or pancreas. Belongs to the delta-EF1/ZFH-1 C2H2-type zinc-finger family.

Protein type: C2H2-type zinc finger protein; Transcription, coactivator/corepressor; Motility/polarity/chemotaxis; DNA-binding

Chromosomal Location of Human Ortholog: 10p11.2

Cellular Component: nucleoplasm; transcription factor complex; cytoplasm; nucleus

Molecular Function: protein binding; zinc ion binding; transcription coactivator activity; double-stranded DNA binding; chromatin binding; transcription factor activity; transcription factor binding; transcription corepressor activity

Biological Process: response to nutrient levels; transcription, DNA-dependent; regulation of T cell differentiation in the thymus; semicircular canal morphogenesis; negative regulation of epithelial cell differentiation; negative regulation of transcription from RNA polymerase II promoter; pattern specification process; embryonic skeletal morphogenesis; regulation of transcription from RNA polymerase II promoter; regulation of mesenchymal cell proliferation; cell proliferation; negative regulation of cell proliferation; regulation of transforming growth factor beta receptor signaling pathway; cartilage development; forebrain development; regulation of smooth muscle cell differentiation; positive regulation of transcription from RNA polymerase II promoter; immune response; embryonic camera-type eye morphogenesis; response to activity; negative regulation of transcription, DNA-dependent; positive regulation of neuron differentiation

Disease: Corneal Dystrophy, Posterior Polymorphous, 3; Corneal Dystrophy, Fuchs Endothelial, 6

Research Articles on ZEB1

Similar Products

Product Notes

The ZEB1 zeb1 (Catalog #AAA3200928) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZEB1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZEB1 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Researchers should empirically determine the suitability of the ZEB1 zeb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KDDECESDAE NEQNHDPNVE EFLQQQDTAV IFPEAPEEDQ RQGTPEASGH. It is sometimes possible for the material contained within the vial of "ZEB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.