Rabbit anti-Human YWHAG Polyclonal Antibody | anti-YWHAG antibody

YWHAG (Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein, gamma Polypeptide, 14-3-3GAMMA) (HRP)

Cat. Num. AAA6451832

• Gene Names: YWHAG; 14-3-3GAMMA
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified
• Synonyms: YWHAG; Polyclonal Antibody; YWHAG (Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein; gamma Polypeptide; 14-3-3GAMMA) (HRP); Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein; 14-3-3GAMMA; anti-YWHAG antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human YWHAG.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-YWHAG antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: YWHAG (NP_036611.2, 1aa-247aa) full-length human protein.
• Immunogen Sequence: MVDREQLVQKARLAEQAERYDDM MKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates.

Western Blot (WB)

(Western Blot analysis of YWHAG expression in transfected 293T cell line by YWHAG MaxPab polyclonal antibody.Lane 1: YWHAG transfected lysate(28.30 KDa).Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-YWHAG antibody

Antibodies; 14-3-3

NCBI and Uniprot Product Information

• NCBI GI #: 21464101
• NCBI GeneID: 7532
• NCBI Accession #: NP_036611.2
• NCBI GenBank Nucleotide #: NM_012479.3
• UniProt Accession #: P61981; O70457; P35214; Q6FH52; Q9UDP2; Q9UN99
• Molecular Weight: 28,303 Da
• NCBI Official Full Name: 14-3-3 protein gamma
• NCBI Official Synonym Full Names: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
• NCBI Official Symbol: YWHAG
• NCBI Official Synonym Symbols: 14-3-3GAMMA
• NCBI Protein Information: 14-3-3 protein gamma; KCIP-1; 14-3-3 gamma; protein kinase C inhibitor protein 1
• UniProt Protein Name: 14-3-3 protein gamma
• Protein Family: 14-3-3 protein
• UniProt Gene Name: YWHAG
• UniProt Synonym Gene Names: KCIP-1
• UniProt Entry Name: 1433G_HUMAN

NCBI Description

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the rat ortholog. It is induced by growth factors in human vascular smooth muscle cells, and is also highly expressed in skeletal and heart muscles, suggesting an important role for this protein in muscle tissue. It has been shown to interact with RAF1 and protein kinase C, proteins involved in various signal transduction pathways. [provided by RefSeq, Jul 2008]

Uniprot Description

14-3-3 gamma: Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Homodimer. Interacts with SAMSN1. Interacts with RAF1, SSH1 and CRTC2/TORC2. Interacts with ABL1 (phosphorylated form); the interaction retains it in the cytoplasm. Interacts with GAB2. Interacts with MDM4 (phosphorylated); negatively regulates MDM4 activity toward TP53. Interacts with PKA-phosphorylated AANAT. Highly expressed in brain, skeletal muscle, and heart. Belongs to the 14-3-3 family.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: focal adhesion; cytoplasmic vesicle membrane; membrane; cytosol

Molecular Function: protein domain specific binding; protein kinase C inhibitor activity; insulin-like growth factor receptor binding; protein binding; protein kinase C binding; receptor tyrosine kinase binding

Biological Process: cellular response to insulin stimulus; apoptosis; regulation of neuron differentiation; organelle organization and biogenesis; regulation of signal transduction; regulation of synaptic plasticity; negative regulation of protein kinase activity; mitotic cell cycle; G2/M transition of mitotic cell cycle; protein targeting