Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Yipf5 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse spleen)

Rabbit Yipf5 Polyclonal Antibody | anti-YIPF5 antibody

Yipf5 antibody - N-terminal region

Gene Names
Ctsz; CTSX; AI787083; AU019819; D2Wsu143e
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Yipf5; Polyclonal Antibody; Yipf5 antibody - N-terminal region; anti-YIPF5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DMMQPQQTYTGQIYQPTQAYPPTTPQPFYGDSFEEEPPLLEELGINFDHI
Sequence Length
257
Applicable Applications for anti-YIPF5 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Yipf5 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse spleen)

Western Blot (WB) (WB Suggested Anti-Yipf5 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse spleen)
Related Product Information for anti-YIPF5 antibody
This is a rabbit polyclonal antibody against Yipf5. It was validated on Western Blot

Target Description: Yipf5 plays a role in transport between endoplasmic reticulum and Golgi.
Product Categories/Family for anti-YIPF5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
cathepsin Z preproprotein
NCBI Official Synonym Full Names
cathepsin Z
NCBI Official Symbol
Ctsz
NCBI Official Synonym Symbols
CTSX; AI787083; AU019819; D2Wsu143e
NCBI Protein Information
cathepsin Z
UniProt Protein Name
Cathepsin Z
Protein Family
UniProt Gene Name
Ctsz
UniProt Entry Name
CATZ_MOUSE

NCBI Description

This gene encodes a member of the peptidase C1 (papain) family of cysteine proteases. The encoded preproprotein is proteolytically processed to generate a mature enzyme with carboxypeptidase activity. An enzymatically inactive form of the protein, that is associated with the propeptide, may be involved in cancer cell invasion and proliferation. Homozygous knockout mice for this gene exhibit impaired cancer cell invasion in a breast cancer model. [provided by RefSeq, Aug 2015]

Uniprot Description

CTSZ: Exhibits carboxy-monopeptidase as well as carboxy- dipeptidase activity. Belongs to the peptidase C1 family.

Protein type: EC 3.4.18.1; Protease

Cellular Component: endoplasmic reticulum; extracellular space; intracellular membrane-bound organelle; lysosome

Molecular Function: cysteine-type endopeptidase activity

Biological Process: proteolysis involved in cellular protein catabolic process

Research Articles on YIPF5

Similar Products

Product Notes

The YIPF5 ctsz (Catalog #AAA3207517) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Yipf5 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Yipf5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the YIPF5 ctsz for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DMMQPQQTYT GQIYQPTQAY PPTTPQPFYG DSFEEEPPLL EELGINFDHI. It is sometimes possible for the material contained within the vial of "Yipf5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.