Rabbit YAP1 Polyclonal Antibody | anti-YAP1 antibody

Anti-YAP1 Antibody

Cat. Num. AAA178467

• Gene Names: YAP1; YAP; YKI; COB1; YAP2; YAP65
• Reactivity: Human, Mouse, Rat; No cross reactivity with other proteins.
• Applications: Western Blot
• Purity: Immunogen affinity purified.
• Synonyms: YAP1; Polyclonal Antibody; Anti-YAP1 Antibody; YAp 1; YAp1; YAP2; YAP 65; YAP65; YKI; Yorkie homolog; P46937; Transcriptional coactivator YAP1; Yes associated protein 1; anti-YAP1 antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat; No cross reactivity with other proteins.
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Immunogen affinity purified.
• Form/Format: Lyophilized
• Sequence Length: 504

• Applicable Applications for anti-YAP1 antibody: Western Blot (WB)
• Application Notes: Western Blot: 0.1-0.5mug/ml; Tested Species: Human, Mouse, Rat; Tested Species:In-house tested species with positive results.; Other applications have not been tested.
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human YAP1 (62-97aa ETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFK), identical to the related mouse and rat sequences.
• Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of YAP1 expression in rat testis extract (lane 1), mouse ovary extract (lane 2), HELA whole cell lysates (lane 3) and MCF-7 whole cell lysates (lane 4). YAP1 at 54KD; 70KD was detected using rabbit anti-YAP1 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Related Product Information for anti-YAP1 antibody

Rabbit IgG polyclonal antibody for Transcriptional coactivator YAP1 (YAP1) detection.
Background: YAP1, also known as YAP or YAP65, is a potent oncogene, which is amplified in various human cancers. This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. It is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms.

References

1. Huang, J., Wu, S., Barrera, J., Matthews, K., Pan, D. (2005). "The Hippo signaling pathway coordinately regulates cell proliferation and apoptosis by inactivating Yorkie, the Drosophila Homolog of YAP". Cell122 (3): 421-34.
2. Overholtzer M, Zhang J, Smolen GA, Muir B, Li W, Sgroi DC, Deng CX, Brugge JS, Haber DA. (2006). "Transforming properties of YAP, a candidate oncogene on the chromosome 11q22 amplicon". Proc Natl Acad Sci U S A. 103 (33): 12405-12410.
3. Sudol M (1994). "Yes-associated protein (YAP65) is a proline-rich phosphoprotein that binds to the SH3 domain of the Yes proto-oncogene product". Oncogene 9 (8): 2145-2152.

NCBI and Uniprot Product Information

• NCBI GI #: 194306653
• NCBI GeneID: 10413
• NCBI Accession #: NP_001123617.1
• NCBI GenBank Nucleotide #: NM_001130145.2
• UniProt Accession #: P46937; Q7Z574; B4DTY1; B7ZA01; E3WEB5; E3WEB6; E9PRV2; F5H202; K0KQ18; K0KYZ8; K0L195; K0L1G3
• Molecular Weight: 54,942 Da
• NCBI Official Full Name: transcriptional coactivator YAP1 isoform 1
• NCBI Official Synonym Full Names: Yes associated protein 1
• NCBI Official Symbol: YAP1
• NCBI Official Synonym Symbols: YAP; YKI; COB1; YAP2; YAP65
• NCBI Protein Information: transcriptional coactivator YAP1
• UniProt Protein Name: Transcriptional coactivator YAP1
• Protein Family: YAP1-binding protein
• UniProt Gene Name: YAP1
• UniProt Synonym Gene Names: YAP65; Yes-associated protein 1
• UniProt Entry Name: YAP1_HUMAN

NCBI Description

This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2013]

Uniprot Description

Transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis (PubMed:17974916, PubMed:18280240, PubMed:18579750, PubMed:21364637). The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ (PubMed:18158288). Plays a key role in tissue tension and 3D tissue shape by regulating cortical actomyosin network formation. Acts via ARHGAP18, a Rho GTPase activating protein that suppresses F-actin polymerization (PubMed:25778702). Plays a key role to control cell proliferation in response to cell contact. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration (PubMed:18158288). The presence of TEAD transcription factors are required for it to stimulate gene expression, cell growth, anchorage-independent growth, and epithelial mesenchymal transition (EMT) induction (PubMed:18579750).