Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (EDA2R rabbit polyclonal antibody. Western Blot analysis of EDA2R expression in mouse liver.)

Rabbit anti-Human, Mouse XEDAR Polyclonal Antibody | anti-XEDAR antibody

XEDAR (Tumor Necrosis Factor Receptor Superfamily Member 27, X-linked Ectodysplasin A2 Receptor, EDA-A2 Receptor, TNFRSF27, EDA-A2R, EDA2R, EDAA2R) (PE)

Gene Names
EDA2R; XEDAR; EDAA2R; EDA-A2R; TNFRSF27
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
XEDAR; Polyclonal Antibody; XEDAR (Tumor Necrosis Factor Receptor Superfamily Member 27; X-linked Ectodysplasin A2 Receptor; EDA-A2 Receptor; TNFRSF27; EDA-A2R; EDA2R; EDAA2R) (PE); anti-XEDAR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human EDA2R. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-XEDAR antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human EDA2R, aa1-297 (NP_068555.1).
Immunogen Sequence
MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAFQLSLVEADAPTVPPQEATLVALVSSLLVVFTLAFLGLFFLYCKQFFNRHCQRGGLLQFEADKTAKEESLFPVPPSKETSAESQVSENIFQTQPLNPILEDDCSSTSGFPTQESFTMASCTSESHSHWVHSPIECTELDLQKFSSSASYTGAETLGGNTVESTGDRLELNVPFEVPSP
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(EDA2R rabbit polyclonal antibody. Western Blot analysis of EDA2R expression in mouse liver.)

Western Blot (WB) (EDA2R rabbit polyclonal antibody. Western Blot analysis of EDA2R expression in mouse liver.)

Western Blot (WB)

(Western Blot analysis of EDA2R expression in transfected 293T cell line by EDA2R polyclonal antibody. Lane 1: EDA2R transfected lysate (32.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of EDA2R expression in transfected 293T cell line by EDA2R polyclonal antibody. Lane 1: EDA2R transfected lysate (32.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-XEDAR antibody
EDA-A1 and EDA-A2 are two isoforms of ectodysplasin that are encoded by the anhidrotic ectodermal dysplasia (EDA) gene. Mutations in EDA give rise to a clinical syndrome characterized by loss of hair, sweat glands, and teeth. The protein encoded by this gene specifically binds to EDA-A2 isoform. This protein is a type III transmembrane protein of the TNFR (tumor necrosis factor receptor) superfamily, and contains 3 cysteine-rich repeats and a single transmembrane domain but lacks an N-terminal signal peptide. Multiple alternatively spliced transcript variants have been found for this gene, but some variants lack sufficient support. [provided by RefSeq]
Product Categories/Family for anti-XEDAR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,959 Da
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 27 isoform 1
NCBI Official Synonym Full Names
ectodysplasin A2 receptor
NCBI Official Symbol
EDA2R
NCBI Official Synonym Symbols
XEDAR; EDAA2R; EDA-A2R; TNFRSF27
NCBI Protein Information
tumor necrosis factor receptor superfamily member 27; EDA-A2 receptor; X-linked ectodysplasin-A2 receptor; tumor necrosis factor receptor superfamily member XEDAR
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 27
UniProt Gene Name
EDA2R
UniProt Synonym Gene Names
TNFRSF27; XEDAR; EDA-A2 receptor
UniProt Entry Name
TNR27_HUMAN

NCBI Description

EDA-A1 and EDA-A2 are two isoforms of ectodysplasin that are encoded by the anhidrotic ectodermal dysplasia (EDA) gene. Mutations in EDA give rise to a clinical syndrome characterized by loss of hair, sweat glands, and teeth. The protein encoded by this gene specifically binds to EDA-A2 isoform. This protein is a type III transmembrane protein of the TNFR (tumor necrosis factor receptor) superfamily, and contains 3 cysteine-rich repeats and a single transmembrane domain but lacks an N-terminal signal peptide. Alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, May 2011]

Uniprot Description

EDA2R: Receptor for EDA isoform A2, but not for EDA isoform A1. Mediates the activation of the NF-kappa-B and JNK pathways. Activation seems to be mediated by binding to TRAF3 and TRAF6. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: Xq12

Cellular Component: integral to plasma membrane; integral to membrane

Molecular Function: protein binding; tumor necrosis factor receptor activity; receptor activity

Biological Process: epidermis development; tumor necrosis factor-mediated signaling pathway; multicellular organismal development; positive regulation of JNK cascade; activation of NF-kappaB transcription factor

Research Articles on XEDAR

Similar Products

Product Notes

The XEDAR eda2r (Catalog #AAA6398732) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The XEDAR (Tumor Necrosis Factor Receptor Superfamily Member 27, X-linked Ectodysplasin A2 Receptor, EDA-A2 Receptor, TNFRSF27, EDA-A2R, EDA2R, EDAA2R) (PE) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's XEDAR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the XEDAR eda2r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "XEDAR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.