Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of XAGE2 expression in transfected 293T cell line by XAGE2 polyclonal antibody. Lane 1: XAGE2 transfected lysate (12.21kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human, Mouse XAGE2 Polyclonal Antibody | anti-XAGE2 antibody

XAGE2 (X Antigen Family Member 2, XAGE-2, Cancer/testis Antigen 12.2, CT12.2, G Antigen Family D Member 3, GAGED3, XAGE2B, CT12.2)

Gene Names
XAGE2; CT12.2; GAGED3; XAGE-2
Reactivity
Human, Mouse
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
XAGE2; Polyclonal Antibody; XAGE2 (X Antigen Family Member 2; XAGE-2; Cancer/testis Antigen 12.2; CT12.2; G Antigen Family D Member 3; GAGED3; XAGE2B; CT12.2); Anti -XAGE2 (X Antigen Family Member 2; anti-XAGE2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human XAGE2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSWRGRSTYRPRPRRSLQPPELIGAMLEPTDEEPKEEKPPTKSRNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV
Applicable Applications for anti-XAGE2 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human XAGE2, aa1-111 (NP_570133.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of XAGE2 expression in transfected 293T cell line by XAGE2 polyclonal antibody. Lane 1: XAGE2 transfected lysate (12.21kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of XAGE2 expression in transfected 293T cell line by XAGE2 polyclonal antibody. Lane 1: XAGE2 transfected lysate (12.21kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to XAGE2 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of purified antibody to XAGE2 on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-XAGE2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,354 Da
NCBI Official Full Name
X antigen family member 2
NCBI Official Synonym Full Names
X antigen family, member 2
NCBI Official Symbol
XAGE2
NCBI Official Synonym Symbols
CT12.2; GAGED3; XAGE-2
NCBI Protein Information
X antigen family member 2; G antigen, family D, 3; cancer/testis antigen 12.2; g antigen family D member 3; cancer/testis antigen family 12, member 2
UniProt Protein Name
X antigen family member 2
Protein Family
UniProt Gene Name
XAGE2
UniProt Synonym Gene Names
GAGED3; XAGE-2; CT12.2
UniProt Entry Name
XAGE2_HUMAN

NCBI Description

This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in normal testis, and in Ewing's sarcoma, rhabdomyosarcoma, a breast cancer and a germ cell tumor. The protein encoded by this gene shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens. [provided by RefSeq, Jul 2008]

Uniprot Description

Sequence similarities: Belongs to the GAGE family.

Similar Products

Product Notes

The XAGE2 xage2 (Catalog #AAA647115) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The XAGE2 (X Antigen Family Member 2, XAGE-2, Cancer/testis Antigen 12.2, CT12.2, G Antigen Family D Member 3, GAGED3, XAGE2B, CT12.2) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's XAGE2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the XAGE2 xage2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSWRGRSTYR PRPRRSLQPP ELIGAMLEPT DEEPKEEKPP TKSRNPTPDQ KREDDQGAAE IQVPDLEADL QELCQTKTGD GCEGGTDVKG KILPKAEHFK MPEAGEGKSQ V. It is sometimes possible for the material contained within the vial of "XAGE2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.