Western Blot (WB)
(WB Suggested Anti-XAGE1D AntibodyTitration: 1.0 ug/mlPositive Control: Fetal kidney)
Rabbit XAGE1D Polyclonal Antibody | anti-XAGE1D antibody
XAGE1D antibody - C-terminal region
Reactivity
Dog, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
XAGE1D; Polyclonal Antibody; XAGE1D antibody - C-terminal region; anti-XAGE1D antibody
Host
Rabbit
Reactivity
Dog, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCKMPEAGEEQPQV
Sequence Length
160
Applicable Applications for anti-XAGE1D antibody
Western Blot (WB)
Homology
Dog: 83%; Human: 100%; Pig: 91%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-XAGE1D AntibodyTitration: 1.0 ug/mlPositive Control: Fetal kidney)
Western Blot (WB)
(WB Suggested Anti-XAGE1D AntibodyTitration: 1.0 ug/mlPositive Control: Fetal kidney)
Related Product Information for anti-XAGE1D antibody
This is a rabbit polyclonal antibody against XAGE1D. It was validated on Western Blot
Target Description: This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in Ewing's sarcoma, alveolar rhabdomyosarcoma and normal testis. The protein encoded by this gene contains a nuclear localization signal and shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens.
Target Description: This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in Ewing's sarcoma, alveolar rhabdomyosarcoma and normal testis. The protein encoded by this gene contains a nuclear localization signal and shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens.
Product Categories/Family for anti-XAGE1D antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18kDa
UniProt Protein Name
X antigen family member 1
UniProt Gene Name
XAGE1A
UniProt Synonym Gene Names
GAGED2; XAGE1; XAGE-1; CT12.1
UniProt Entry Name
XAGE1_HUMAN
Uniprot Description
XAGE1A/B/C/D/E: a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. strongly expressed in Ewing's sarcoma, alveolar rhabdomyosarcoma and normal testis. The protein encoded by this gene contains a nuclear localization signal and shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens. Alternative splicing of this gene, in addition to alternative transcription start sites, results in multiple transcript variants. [provided by RefSeq, Jan 2010]
Protein type: Cancer Testis Antigen (CTA)
Chromosomal Location of Human Ortholog: Xp11.22
Similar Products
Product Notes
The XAGE1D xage1a (Catalog #AAA3214924) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The XAGE1D antibody - C-terminal region reacts with Dog, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's XAGE1D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the XAGE1D xage1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QCATWKVICK SCISQTPGIN LDLGSGVKVK IIPKEEHCKM PEAGEEQPQV. It is sometimes possible for the material contained within the vial of "XAGE1D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
