Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-WWOX AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole CellThere is BioGPS gene expression data showing that WWOX is expressed in COLO205)

Rabbit WWOX Polyclonal Antibody | anti-WWOX antibody

WWOX antibody - C-terminal region

Gene Names
WWOX; FOR; WOX1; EIEE28; FRA16D; SCAR12; HHCMA56; PRO0128; SDR41C1; D16S432E
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
WWOX; Polyclonal Antibody; WWOX antibody - C-terminal region; anti-WWOX antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSF
Sequence Length
189
Applicable Applications for anti-WWOX antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 92%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-WWOX AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole CellThere is BioGPS gene expression data showing that WWOX is expressed in COLO205)

Western Blot (WB) (WB Suggested Anti-WWOX AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole CellThere is BioGPS gene expression data showing that WWOX is expressed in COLO205)
Related Product Information for anti-WWOX antibody
This is a rabbit polyclonal antibody against WWOX. It was validated on Western Blot

Target Description: WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 2 WW domains and a short-chain dehydrogenase/reductase domain (SRD). The highest normal expression of this gene is detected in hormonally regulated tissues such as testis, ovary, and prostate. This expression pattern and the presence of an SRD domain suggest a role for this gene in steroid metabolism. The encoded protein is more than 90% identical to the mouse protein, which is an essential mediator of tumor necrosis factor-alpha-induced apoptosis, suggesting a similar, important role in apoptosis for the human protein. In addition, there is evidence that this gene behaves as a suppressor of tumor growth. Alternative splicing of this gene generates transcript variants that encode different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
WW domain-containing oxidoreductase isoform 1
NCBI Official Synonym Full Names
WW domain containing oxidoreductase
NCBI Official Symbol
WWOX
NCBI Official Synonym Symbols
FOR; WOX1; EIEE28; FRA16D; SCAR12; HHCMA56; PRO0128; SDR41C1; D16S432E
NCBI Protein Information
WW domain-containing oxidoreductase
UniProt Protein Name
WW domain-containing oxidoreductase
UniProt Gene Name
WWOX
UniProt Synonym Gene Names
FOR; WOX1
UniProt Entry Name
WWOX_HUMAN

NCBI Description

This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) protein family. This gene spans the FRA16D common chromosomal fragile site and appears to function as a tumor suppressor gene. Expression of the encoded protein is able to induce apoptosis, while defects in this gene are associated with multiple types of cancer. Disruption of this gene is also associated with autosomal recessive spinocerebellar ataxia 12. Disruption of a similar gene in mouse results in impaired steroidogenesis, additionally suggesting a metabolic function for the protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]

Uniprot Description

WWOX: an enzyme which contains 2 WW domains and a short-chain dehydrogenase/reductase domain (SRD). Expressed at high levels in hormonally regulated tissues such as testis, ovary, and prostate. Its SRD domain suggest a role for this gene in steroid metabolism. Shown to be an essential mediator of tumor necrosis factor-alpha-induced apoptosis in the mouse. May play a similar role in the human. May function as a suppressor of tumor growth. Alternative splicing of this gene generates 7 isoforms.

Protein type: Tumor suppressor; Oxidoreductase; EC 1.1.1.-; Apoptosis

Chromosomal Location of Human Ortholog: 16q23

Cellular Component: Golgi apparatus; microvillus; mitochondrion; cytoplasm; plasma membrane; nucleus; cytosol

Molecular Function: protein dimerization activity; protein binding; enzyme binding; oxidoreductase activity; coenzyme binding; cofactor binding

Biological Process: osteoblast differentiation; steroid metabolic process; Wnt receptor signaling pathway; negative regulation of Wnt receptor signaling pathway; skeletal morphogenesis; positive regulation of transcription from RNA polymerase II promoter

Disease: Epileptic Encephalopathy, Early Infantile, 28

Research Articles on WWOX

Similar Products

Product Notes

The WWOX wwox (Catalog #AAA3215212) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WWOX antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's WWOX can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WWOX wwox for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DDNPTKPTTR QRYDGSTTAM EILQGRDFTG KVVVVTGANS GIGFETAKSF. It is sometimes possible for the material contained within the vial of "WWOX, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.