Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-WWC1 AntibodyTitration: 1.0 ug/mlPositive Control: PANC1 Whole Cell)

Rabbit WWC1 Polyclonal Antibody | anti-WWC1 antibody

WWC1 Antibody - C-terminal region

Gene Names
WWC1; KIBRA; HBEBP3; HBEBP36; MEMRYQTL; PPP1R168
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
WWC1; Polyclonal Antibody; WWC1 Antibody - C-terminal region; anti-WWC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SRELKPVGVMAPASGPASTDAVSALLEQTAVELEKRQEGRSSTQTLEDSW
Sequence Length
1113
Applicable Applications for anti-WWC1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 79%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 79%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human WWC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-WWC1 AntibodyTitration: 1.0 ug/mlPositive Control: PANC1 Whole Cell)

Western Blot (WB) (WB Suggested Anti-WWC1 AntibodyTitration: 1.0 ug/mlPositive Control: PANC1 Whole Cell)
Related Product Information for anti-WWC1 antibody
This is a rabbit polyclonal antibody against WWC1. It was validated on Western Blot

Target Description: The protein encoded by this gene is a cytoplasmic phosphoprotein that interacts with PRKC-zeta and dynein light chain-1. Alleles of this gene have been found that enhance memory in some individuals. Three transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-WWC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
125kDa
NCBI Official Full Name
protein KIBRA isoform 3
NCBI Official Synonym Full Names
WW and C2 domain containing 1
NCBI Official Symbol
WWC1
NCBI Official Synonym Symbols
KIBRA; HBEBP3; HBEBP36; MEMRYQTL; PPP1R168
NCBI Protein Information
protein KIBRA
UniProt Protein Name
Protein KIBRA
UniProt Gene Name
WWC1
UniProt Synonym Gene Names
KIAA0869; KIBRA
UniProt Entry Name
KIBRA_HUMAN

NCBI Description

The protein encoded by this gene is a cytoplasmic phosphoprotein that interacts with PRKC-zeta and dynein light chain-1. Alleles of this gene have been found that enhance memory in some individuals. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010]

Uniprot Description

KIBRA: a postsynaptic scaffolding protein associated with human memory performance. Interacts via its WW domains with the postsynaptic protein DDN, which plays a role in synaptic plasticity. Expressed in the hypothalamus and cerebellum, and in the hippocampus and cortex, both regions of the brain that are related to memory. Co-localizes with PKCZ in the mouse hippocampus. Binds to synaptopodin, modulating podocyte directional migration. Forms a complex with dynein light chain 1 that is recruited to ER-responsive promoters, and that is required for ER transactivation in breast cancer cells. Binds the minus end-directed microtubule motor dynein. Its amino terminus binds the eight PDZ domain of the polarity protein INADL . Two human isoforms have been described.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 5q34

Cellular Component: protein complex; perinuclear region of cytoplasm; cytoplasm; nucleus; cytosol

Molecular Function: protein binding, bridging; protein binding; transcription coactivator activity; protein complex scaffold; kinase binding

Biological Process: cell migration; regulation of intracellular transport; positive regulation of MAPKKK cascade; transcription, DNA-dependent; establishment of cell polarity; negative regulation of transcription from RNA polymerase II promoter; negative regulation of organ growth

Disease: Memory Quantitative Trait Locus

Research Articles on WWC1

Similar Products

Product Notes

The WWC1 wwc1 (Catalog #AAA3216560) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WWC1 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's WWC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WWC1 wwc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SRELKPVGVM APASGPASTD AVSALLEQTA VELEKRQEGR SSTQTLEDSW. It is sometimes possible for the material contained within the vial of "WWC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.