Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of WNT8A expression in transfected 293T cell line by WNT8A polyclonal antibody. Lane 1: WNT8A transfected lysate (38.8kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human WNT8A Polyclonal Antibody | anti-WNT8A antibody

WNT8A (Wingless-type MMTV Integration Site Family Member 8A, Protein Wnt-8a, Protein Wnt-8d, WNT8D) APC

Gene Names
WNT8A; WNT8D
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
WNT8A; Polyclonal Antibody; WNT8A (Wingless-type MMTV Integration Site Family Member 8A; Protein Wnt-8a; Protein Wnt-8d; WNT8D) APC; anti-WNT8A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human WNT8A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-WNT8A antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human WNT8A, aa1-351 (NP_490645.1).
Immunogen Sequence
MGNLFMLWAALGICCAAFSASAWSVNNFLITGPKAYLTYTTSVALGAQSGIEECKFQFAWERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMYIITKNCSMGDFENCGCDGSNNGKTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVRATMKRTCKCHGISGSCSIQTCWLQLAEFREMGDYLKAKYDQALKIEMDKRQLRAGNSAEGHWVPAEAFLPSAEAELIFLEESPDYCTCNSSLGIYGTEGRECLQNSHNTSRWERRSCGRLCTECGLQVEERKTEVISSCNCKFQWCCTVKCDQCRHVVSKYYCARSPGSAQSLGKGSA
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of WNT8A expression in transfected 293T cell line by WNT8A polyclonal antibody. Lane 1: WNT8A transfected lysate (38.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of WNT8A expression in transfected 293T cell line by WNT8A polyclonal antibody. Lane 1: WNT8A transfected lysate (38.8kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-WNT8A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,527 Da
NCBI Official Full Name
protein Wnt-8a isoform 3
NCBI Official Synonym Full Names
wingless-type MMTV integration site family, member 8A
NCBI Official Symbol
WNT8A
NCBI Official Synonym Symbols
WNT8D
NCBI Protein Information
protein Wnt-8a; WNT8d; protein Wnt-8d
UniProt Protein Name
Protein Wnt-8a
Protein Family
UniProt Gene Name
WNT8A
UniProt Synonym Gene Names
WNT8D
UniProt Entry Name
WNT8A_HUMAN

NCBI Description

The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family, and may be implicated in development of early embryos as well as germ cell tumors. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2014]

Uniprot Description

WNT8A: Ligand for members of the frizzled family of seven transmembrane receptors. May play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus. Belongs to the Wnt family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Extracellular matrix; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: proteinaceous extracellular matrix; extracellular space; extracellular region

Molecular Function: frizzled binding; receptor agonist activity

Biological Process: neuron differentiation; response to retinoic acid; neural crest cell fate commitment; Wnt receptor signaling pathway through beta-catenin; palate development

Research Articles on WNT8A

Similar Products

Product Notes

The WNT8A wnt8a (Catalog #AAA6398635) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WNT8A (Wingless-type MMTV Integration Site Family Member 8A, Protein Wnt-8a, Protein Wnt-8d, WNT8D) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WNT8A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the WNT8A wnt8a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "WNT8A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.