Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of WNT6 expression in transfected 293T cell line by WNT6 polyclonal antibody. Lane 1: WNT6 transfected lysate (39.7kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human WNT6 Polyclonal Antibody | anti-WNT6 antibody

WNT6 (Wingless-type MMTV Integration Site Family Member 6, Protein Wnt-6) (HRP)

Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
WNT6; Polyclonal Antibody; WNT6 (Wingless-type MMTV Integration Site Family Member 6; Protein Wnt-6) (HRP); anti-WNT6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human WNT6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-WNT6 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human WNT6, aa1-365 (NP_006513.1).
Immunogen Sequence
MLPPLPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of WNT6 expression in transfected 293T cell line by WNT6 polyclonal antibody. Lane 1: WNT6 transfected lysate (39.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of WNT6 expression in transfected 293T cell line by WNT6 polyclonal antibody. Lane 1: WNT6 transfected lysate (39.7kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-WNT6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,721 Da
NCBI Official Full Name
protein Wnt-6
NCBI Official Synonym Full Names
wingless-type MMTV integration site family, member 6
NCBI Official Symbol
WNT6
NCBI Protein Information
protein Wnt-6
UniProt Protein Name
Protein Wnt-6
Protein Family
UniProt Gene Name
WNT6
UniProt Entry Name
WNT6_HUMAN

NCBI Description

The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is overexpressed in cervical cancer cell line and strongly coexpressed with another family member, WNT10A, in colorectal cancer cell line. The gene overexpression may play key roles in carcinogenesis. This gene and the WNT10A gene are clustered in the chromosome 2q35 region. The protein encoded by this gene is 97% identical to the mouse Wnt6 protein at the amino acid level. [provided by RefSeq, Jul 2008]

Uniprot Description

WNT6: Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters. Belongs to the Wnt family.

Protein type: Secreted; Secreted, signal peptide; Cell development/differentiation; Extracellular matrix

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: proteinaceous extracellular matrix; extracellular space; cell surface; endoplasmic reticulum lumen; Golgi lumen; plasma membrane; extracellular region

Molecular Function: frizzled binding

Biological Process: neuron differentiation; cell fate commitment; Wnt receptor signaling pathway; ureteric bud branching; positive regulation of transcription, DNA-dependent; axis specification; odontogenesis of dentine-containing teeth

Research Articles on WNT6

Similar Products

Product Notes

The WNT6 wnt6 (Catalog #AAA6398627) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WNT6 (Wingless-type MMTV Integration Site Family Member 6, Protein Wnt-6) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WNT6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the WNT6 wnt6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "WNT6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.