Rabbit anti-Human WNT6 Polyclonal Antibody | anti-WNT6 antibody

WNT6 (Wingless-type MMTV Integration Site Family Member 6, Protein Wnt-6) (HRP)

Cat. Num. AAA6398627

• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: WNT6; Polyclonal Antibody; WNT6 (Wingless-type MMTV Integration Site Family Member 6; Protein Wnt-6) (HRP); anti-WNT6 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human WNT6.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-WNT6 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human WNT6, aa1-365 (NP_006513.1).
• Immunogen Sequence: MLPPLPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of WNT6 expression in transfected 293T cell line by WNT6 polyclonal antibody. Lane 1: WNT6 transfected lysate (39.7kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-WNT6 antibody

Antibodies; Wnt Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 16507239
• NCBI GeneID: 7475
• NCBI Accession #: NP_006513.1
• NCBI GenBank Nucleotide #: NM_006522
• UniProt Accession #: Q9Y6F9; Q9H1J6; Q9H238
• Molecular Weight: 39,721 Da
• NCBI Official Full Name: protein Wnt-6
• NCBI Official Synonym Full Names: wingless-type MMTV integration site family, member 6
• NCBI Official Symbol: WNT6
• NCBI Protein Information: protein Wnt-6
• UniProt Protein Name: Protein Wnt-6
• Protein Family: Protein
• UniProt Gene Name: WNT6
• UniProt Entry Name: WNT6_HUMAN

NCBI Description

The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is overexpressed in cervical cancer cell line and strongly coexpressed with another family member, WNT10A, in colorectal cancer cell line. The gene overexpression may play key roles in carcinogenesis. This gene and the WNT10A gene are clustered in the chromosome 2q35 region. The protein encoded by this gene is 97% identical to the mouse Wnt6 protein at the amino acid level. [provided by RefSeq, Jul 2008]

Uniprot Description

WNT6: Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters. Belongs to the Wnt family.

Protein type: Secreted; Secreted, signal peptide; Cell development/differentiation; Extracellular matrix

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: proteinaceous extracellular matrix; extracellular space; cell surface; endoplasmic reticulum lumen; Golgi lumen; plasma membrane; extracellular region

Molecular Function: frizzled binding

Biological Process: neuron differentiation; cell fate commitment; Wnt receptor signaling pathway; ureteric bud branching; positive regulation of transcription, DNA-dependent; axis specification; odontogenesis of dentine-containing teeth