Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: WNT1Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Rabbit Wnt1 Polyclonal Antibody | anti-WNT1 antibody

Wnt1 Antibody - C-terminal region

Gene Names
Wnt1; sw; Int-1; Wnt-1; swaying
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Wnt1; Polyclonal Antibody; Wnt1 Antibody - C-terminal region; anti-WNT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCN
Sequence Length
370
Applicable Applications for anti-WNT1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Wnt1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: WNT1Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: WNT1Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)
Related Product Information for anti-WNT1 antibody
This is a rabbit polyclonal antibody against Wnt1. It was validated on Western Blot

Target Description: Wnt1 is a ligand for members of the frizzled family of seven transmembrane receptors. In some developmental processes, it is also a ligand for the coreceptor RYK, thus triggering Wnt signaling. It is a probable developmental protein and may be a signaling molecule important in CNS development. Wnt1 is likely to signal over only few cell diameters. It ha s a proeminent role in the induction of the mesencephalon and cerebellum. It may play a crucial role in the morphogenesis of the neural tube and/or the early stages of CNS development. It has a role in osteoblast function and bone development.
Product Categories/Family for anti-WNT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
proto-oncogene Wnt-1
NCBI Official Synonym Full Names
wingless-type MMTV integration site family, member 1
NCBI Official Symbol
Wnt1
NCBI Official Synonym Symbols
sw; Int-1; Wnt-1; swaying
NCBI Protein Information
proto-oncogene Wnt-1
UniProt Protein Name
Proto-oncogene Wnt-1
UniProt Gene Name
Wnt1
UniProt Synonym Gene Names
Int-1; Wnt-1
UniProt Entry Name
WNT1_MOUSE

Uniprot Description

WNT1: Ligand for members of the frizzled family of seven transmembrane receptors. In some developmental processes, is also a ligand for the coreceptor RYK, thus triggering Wnt signaling. Probable developmental protein. May be a signaling molecule important in CNS development. Is likely to signal over only few cell diameters. Belongs to the Wnt family.

Protein type: Cell development/differentiation; Secreted; Oncoprotein; Secreted, signal peptide; Motility/polarity/chemotaxis

Cellular Component: extracellular space; proteinaceous extracellular matrix; cell surface; cytoplasm; extracellular region

Molecular Function: protein domain specific binding; protein binding; frizzled binding; cytokine activity; receptor binding

Biological Process: positive regulation of insulin-like growth factor receptor signaling pathway; positive regulation of transcription, DNA-dependent; multicellular organismal development; T cell differentiation in the thymus; Wnt receptor signaling pathway through beta-catenin; signal transduction; ubiquitin-dependent SMAD protein catabolic process; diencephalon development; negative regulation of BMP signaling pathway; BMP signaling pathway; cerebellum formation; positive regulation of fibroblast proliferation; cell-cell signaling; positive regulation of cell proliferation; midbrain development; midbrain-hindbrain boundary maturation during brain development; myoblast fusion; positive regulation of Notch signaling pathway; neuron fate determination; inner ear morphogenesis; organ regeneration; Wnt receptor signaling pathway; embryonic axis specification; neuron fate commitment; myotube differentiation; DNA damage response, signal transduction; negative regulation of fat cell differentiation; metencephalon development; organ morphogenesis; negative regulation of cell differentiation; central nervous system morphogenesis; ureteric bud branching; midbrain-hindbrain boundary development; forebrain anterior/posterior pattern formation; spinal cord association neuron differentiation; positive regulation of transcription factor activity; positive regulation of transcription from RNA polymerase II promoter; negative regulation of cell-cell adhesion; positive regulation of protein amino acid phosphorylation; negative regulation of transforming growth factor beta receptor signaling pathway; Spemann organizer formation

Research Articles on WNT1

Similar Products

Product Notes

The WNT1 wnt1 (Catalog #AAA3200761) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Wnt1 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Wnt1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WNT1 wnt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NFCTYSGRLG TAGTAGRACN SSSPALDGCE LLCCGRGHRT RTQRVTERCN. It is sometimes possible for the material contained within the vial of "Wnt1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.