Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: WIPI1Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human WIPI1 Polyclonal Antibody | anti-WIPI1 antibody

WIPI1 Antibody - middle region

Gene Names
WIPI1; ATG18; ATG18A; WIPI49
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
WIPI1; Polyclonal Antibody; WIPI1 Antibody - middle region; anti-WIPI1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGE
Sequence Length
446
Applicable Applications for anti-WIPI1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human WIPI1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: WIPI1Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: WIPI1Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-WIPI1 antibody
This gene encodes a WD40 repeat protein. Members of the WD40 repeat family are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI subfamily of WD40 repeat proteins have a 7-bladed propeller structure and contain a conserved motif for interaction with phospholipids. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-WIPI1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49 kDa
NCBI Official Full Name
WD repeat domain phosphoinositide-interacting protein 1 isoform a
NCBI Official Synonym Full Names
WD repeat domain, phosphoinositide interacting 1
NCBI Official Symbol
WIPI1
NCBI Official Synonym Symbols
ATG18; ATG18A; WIPI49
NCBI Protein Information
WD repeat domain phosphoinositide-interacting protein 1
UniProt Protein Name
WD repeat domain phosphoinositide-interacting protein 1
UniProt Gene Name
WIPI1
UniProt Synonym Gene Names
WIPI49; WIPI-1; WIPI 49 kDa
UniProt Entry Name
WIPI1_HUMAN

NCBI Description

This gene encodes a WD40 repeat protein. Members of the WD40 repeat family are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI subfamily of WD40 repeat proteins have a 7-bladed propeller structure and contain a conserved motif for interaction with phospholipids. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]

Uniprot Description

ATG18: May play a role in autophagy. May regulate the trafficking of proteins involved in the mannose-6-phosphate receptor (MPR) recycling pathway. Probably interacts with androgen (AR) and the estrogen receptor (ER). Binds PtdIns3P and to a lesser extent, PtdIns3,5P2 and PtdIns5P in vitro. Interaction with PtdIns3P is required for recruitment to membranes. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Autophagy

Chromosomal Location of Human Ortholog: 17q24.2

Cellular Component: Golgi membrane; cytoskeleton; extrinsic to membrane; clathrin-coated vesicle; pre-autophagosomal structure membrane; cytoplasm; endosome membrane; trans-Golgi network; cytosol

Molecular Function: androgen receptor binding; estrogen receptor binding; phosphatidylinositol 3-phosphate binding; receptor binding

Biological Process: cellular protein metabolic process; unfolded protein response, activation of signaling protein activity; unfolded protein response; protein amino acid lipidation; mitochondrion degradation; autophagy; autophagic vacuole formation; cellular response to nitrogen starvation; vesicle targeting, trans-Golgi to endosome

Research Articles on WIPI1

Similar Products

Product Notes

The WIPI1 wipi1 (Catalog #AAA3221938) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WIPI1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WIPI1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WIPI1 wipi1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LGSGTTEENK ENDLRPSLPQ SYAATVARPS ASSASTVPGY SEDGGALRGE. It is sometimes possible for the material contained within the vial of "WIPI1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.