Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-WDR77 Antibody Titration: 0.2-1 ug/mlPositive Control: 293T cell lysateWDR77 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Rabbit WDR77 Polyclonal Antibody | anti-WDR77 antibody

WDR77 antibody - N-terminal region

Gene Names
WDR77; p44; MEP50; MEP-50; HKMT1069; Nbla10071; p44/Mep50
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
WDR77; Polyclonal Antibody; WDR77 antibody - N-terminal region; anti-WDR77 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLS
Sequence Length
342
Applicable Applications for anti-WDR77 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human WDR77
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-WDR77 Antibody Titration: 0.2-1 ug/mlPositive Control: 293T cell lysateWDR77 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Western Blot (WB) (WB Suggested Anti-WDR77 Antibody Titration: 0.2-1 ug/mlPositive Control: 293T cell lysateWDR77 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)
Related Product Information for anti-WDR77 antibody
This is a rabbit polyclonal antibody against WDR77. It was validated on Western Blot

Target Description: WDR77 is the non-catalytic component of the 20S PRMT5-containing methyltransferase complex, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins. This modification targets Sm proteins to the survival of motor neurons (SMN) complex for assembly into small nuclear ribonucleoprotein core particles. WDR77 might play a role in transcription regulation. The 20S PRMT5-containing methyltransferase complex also methylates the Piwi proteins (PIWIL1, PIWIL2 and PIWIL4), methylation of Piwi proteins being required for the interaction with Tudor domain-containing proteins and subsequent localization to the meiotic nuage.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
methylosome protein 50 isoform 2
NCBI Official Synonym Full Names
WD repeat domain 77
NCBI Official Symbol
WDR77
NCBI Official Synonym Symbols
p44; MEP50; MEP-50; HKMT1069; Nbla10071; p44/Mep50
NCBI Protein Information
methylosome protein 50
UniProt Protein Name
Methylosome protein 50
Protein Family
UniProt Gene Name
WDR77
UniProt Synonym Gene Names
MEP50; WD45; MEP-50
UniProt Entry Name
MEP50_HUMAN

NCBI Description

The protein encoded by this gene is an androgen receptor coactivator that forms a complex with protein arginine methyltransferase 5, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins. The encoded protein may be involved in the early stages of prostate cancer, with most of the protein being nuclear-localized in benign cells but cytoplasmic in cancer cells. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]

Uniprot Description

WDR77: a WD40 repeat protein. Component of the methylosome, a 20S complex containing at least ICLN, SKB1 and WDR77. Interacts with SKB1 and with SM proteins. The methylosome may regulate an early step in the assembly of U snRNPs, possibly the transfer of Sm proteins to the SMN-complex. WD40 repeats are found in a number of eukaryotic proteins that coordinate multi-protein complex assemblies. WD40 proteins are implicated in many functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly.

Protein type: Transcription, coactivator/corepressor; Nuclear receptor co-regulator; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 1p13.2

Cellular Component: nucleoplasm; Golgi apparatus; cytoplasm; nucleus; cytosol

Molecular Function: protein binding; ligand-dependent nuclear receptor transcription coactivator activity

Biological Process: regulation of transcription from RNA polymerase II promoter; establishment and/or maintenance of chromatin architecture; spliceosomal snRNP biogenesis; positive regulation of cell proliferation; gene expression

Research Articles on WDR77

Similar Products

Product Notes

The WDR77 wdr77 (Catalog #AAA3214012) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WDR77 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's WDR77 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WDR77 wdr77 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MRKETPPPLV PPAAREWNLP PNAPACMERQ LEAARYRSDG ALLLGASSLS. It is sometimes possible for the material contained within the vial of "WDR77, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.