Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-WDR66 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Rabbit WDR66 Polyclonal Antibody | anti-WDR66 antibody

WDR66 antibody - N-terminal region

Gene Names
WDR66; SPGF33; CFAP251; CaM-IP4
Reactivity
Dog, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
WDR66; Polyclonal Antibody; WDR66 antibody - N-terminal region; anti-WDR66 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GELEEKTDRMPQDELGQERRDLEPENREEGQERRVSDIQSKAGISRESLV
Sequence Length
1149
Applicable Applications for anti-WDR66 antibody
Western Blot (WB)
Homology
Dog: 100%; Human: 100%; Pig: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human WDR66
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-WDR66 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-WDR66 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
Related Product Information for anti-WDR66 antibody
This is a rabbit polyclonal antibody against WDR66. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: WDR66 contains 9 WD repeats. The functions of WDR66 remain unknown.
Product Categories/Family for anti-WDR66 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
130kDa
NCBI Official Full Name
cilia- and flagella-associated protein 251 isoform 2
NCBI Official Synonym Full Names
WD repeat domain 66
NCBI Official Symbol
WDR66
NCBI Official Synonym Symbols
SPGF33; CFAP251; CaM-IP4
NCBI Protein Information
cilia- and flagella-associated protein 251
UniProt Protein Name
WD repeat-containing protein 66
UniProt Gene Name
WDR66

NCBI Description

This protein encoded by this gene belongs to the WD repeat-containing family of proteins, which function in the formation of protein-protein complexes in a variety of biological pathways. This family member appears to function in the determination of mean platelet volume (MPV), and polymorphisms in this gene have been associated with variance in MPV. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Sep 2011]

Uniprot Description

WDR66: This protein encoded by this gene belongs to the WD repeat-containing family of proteins, which function in the formation of protein-protein complexes in a variety of biological pathways. This family member appears to function in the determination of mean platelet volume (MPV), and polymorphisms in this gene have been associated with variance in MPV. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Sep 2011]

Chromosomal Location of Human Ortholog: 12q24.31

Research Articles on WDR66

Similar Products

Product Notes

The WDR66 wdr66 (Catalog #AAA3210944) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WDR66 antibody - N-terminal region reacts with Dog, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's WDR66 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WDR66 wdr66 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GELEEKTDRM PQDELGQERR DLEPENREEG QERRVSDIQS KAGISRESLV. It is sometimes possible for the material contained within the vial of "WDR66, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.