Western Blot (WB)
(WB Suggested Anti-Wdr5 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Pancreas)
Rabbit Wdr5 Polyclonal Antibody | anti-WDR5 antibody
Wdr5 antibody - C-terminal region
Gene Names
Wdr5; Big; Big-3; AA408785; AA960360; 2410008O07Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Wdr5; Polyclonal Antibody; Wdr5 antibody - C-terminal region; anti-WDR5 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTEN
Sequence Length
334
Applicable Applications for anti-WDR5 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Wdr5 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Pancreas)
Western Blot (WB)
(WB Suggested Anti-Wdr5 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Pancreas)
Related Product Information for anti-WDR5 antibody
This is a rabbit polyclonal antibody against Wdr5. It was validated on Western Blot
Target Description: Wdr5 contributes to histone modification. It may position the N-terminus of histone H3 for efficient trimethylation at 'Lys-4'. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. It may regulate osteoblasts differentiation.
Target Description: Wdr5 contributes to histone modification. It may position the N-terminus of histone H3 for efficient trimethylation at 'Lys-4'. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. It may regulate osteoblasts differentiation.
Product Categories/Family for anti-WDR5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
WD repeat-containing protein 5
NCBI Official Synonym Full Names
WD repeat domain 5
NCBI Official Symbol
Wdr5
NCBI Official Synonym Symbols
Big; Big-3; AA408785; AA960360; 2410008O07Rik
NCBI Protein Information
WD repeat-containing protein 5
UniProt Protein Name
WD repeat-containing protein 5
Protein Family
UniProt Gene Name
Wdr5
UniProt Synonym Gene Names
Big; Big3
Uniprot Description
WDR5: a WD40 repeat protein. May accelerate osteoblast differentiation. Interacts with HCFC1. WD40 repeats are found in a number of eukaryotic proteins that coordinate multi-protein complex assemblies. WD40 proteins are implicated in many functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly.
Protein type: Adaptor/scaffold
Chromosomal Location of Human Ortholog: 2|2 A3
Cellular Component: histone acetyltransferase complex; histone methyltransferase complex; intracellular; nucleoplasm; nucleus
Molecular Function: histone acetyltransferase activity (H4-K16 specific); histone methyltransferase activity (H3-K4 specific); methylated histone residue binding; protein binding
Biological Process: covalent chromatin modification; histone H3-K4 methylation; neuron projection development; regulation of transcription, DNA-templated; skeletal system development; transcription, DNA-dependent
Research Articles on WDR5
Similar Products
Product Notes
The WDR5 wdr5 (Catalog #AAA3205770) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Wdr5 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Wdr5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WDR5 wdr5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NFSVTGGKWI VSGSEDNLVY IWNLQTKEIV QKLQGHTDVV ISTACHPTEN. It is sometimes possible for the material contained within the vial of "Wdr5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
