Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-WBP2NL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Rabbit WBP2NL Polyclonal Antibody | anti-WBP2NL antibody

WBP2NL antibody - N-terminal region

Gene Names
WBP2NL; PAWP; GRAMD7
Reactivity
Cow, Dog, Guinea Pig, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
WBP2NL; Polyclonal Antibody; WBP2NL antibody - N-terminal region; anti-WBP2NL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGT
Sequence Length
309
Applicable Applications for anti-WBP2NL antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 85%; Guinea Pig: 85%; Human: 100%; Pig: 92%; Rabbit: 77%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human WBP2NL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-WBP2NL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-WBP2NL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)
Related Product Information for anti-WBP2NL antibody
This is a rabbit polyclonal antibody against WBP2NL. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: WBP2NL may play a role in meotic resumption and pronuclear formation, mediated by a WW domain-signaling pathway during fertilization.
Product Categories/Family for anti-WBP2NL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
postacrosomal sheath WW domain-binding protein
NCBI Official Synonym Full Names
WBP2 N-terminal like
NCBI Official Symbol
WBP2NL
NCBI Official Synonym Symbols
PAWP; GRAMD7
NCBI Protein Information
postacrosomal sheath WW domain-binding protein
UniProt Protein Name
Postacrosomal sheath WW domain-binding protein
UniProt Gene Name
WBP2NL
UniProt Synonym Gene Names
PAWP

NCBI Description

WBP2NL is a sperm-specific WW domain-binding protein that promotes meiotic resumption and pronuclear development during oocyte fertilization (Wu et al., 2007 [PubMed 17289678]).[supplied by OMIM, Mar 2008]

Uniprot Description

WBP2NL: May play a role in meotic resumption and pronuclear formation, mediated by a WW domain-signaling pathway during fertilization.

Chromosomal Location of Human Ortholog: 22q13.2

Molecular Function: WW domain binding

Biological Process: egg activation; female pronucleus assembly; male pronucleus assembly; meiotic cell cycle

Research Articles on WBP2NL

Similar Products

Product Notes

The WBP2NL wbp2nl (Catalog #AAA3211115) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WBP2NL antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's WBP2NL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WBP2NL wbp2nl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAVNQSHTEN RRGALIPNGE SLLKRSPNVE LSFPQRSEGS NVFSGRKTGT. It is sometimes possible for the material contained within the vial of "WBP2NL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.