Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of VSTM2L expression in transfected 293T cell line by VSTM2L polyclonal antibody. Lane 1: VSTM2L transfected lysate (22.3kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human VSTM2L Polyclonal Antibody | anti-VSTM2L antibody

VSTM2L (C20orf102, V-set and Transmembrane Domain-containing Protein 2-like Protein, DJ1118M15.2)

Gene Names
VSTM2L; C20orf102; dJ1118M15.2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
VSTM2L; Polyclonal Antibody; VSTM2L (C20orf102; V-set and Transmembrane Domain-containing Protein 2-like Protein; DJ1118M15.2); Anti -VSTM2L (C20orf102; anti-VSTM2L antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human VSTM2L.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MGAPLAVALGALHYLALFLQLGGATRPAGHAPWDNHVSGHALFTETPHDMTARTGEDVEMACSFRGSGSPSYSLEIQWWYVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGTYECRVIDFSDGKARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQEACSL
Applicable Applications for anti-VSTM2L antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human VSTM2L, aa1-204 (NP_542174.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of VSTM2L expression in transfected 293T cell line by VSTM2L polyclonal antibody. Lane 1: VSTM2L transfected lysate (22.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of VSTM2L expression in transfected 293T cell line by VSTM2L polyclonal antibody. Lane 1: VSTM2L transfected lysate (22.3kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-VSTM2L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,349 Da
NCBI Official Full Name
V-set and transmembrane domain-containing protein 2-like protein
NCBI Official Synonym Full Names
V-set and transmembrane domain containing 2 like
NCBI Official Symbol
VSTM2L
NCBI Official Synonym Symbols
C20orf102; dJ1118M15.2
NCBI Protein Information
V-set and transmembrane domain-containing protein 2-like protein
UniProt Protein Name
V-set and transmembrane domain-containing protein 2-like protein
UniProt Gene Name
VSTM2L
UniProt Synonym Gene Names
C20orf102
UniProt Entry Name
VTM2L_HUMAN

Uniprot Description

Sequence similarities: Contains 1 Ig-like (immunoglobulin-like) domain.

Research Articles on VSTM2L

Similar Products

Product Notes

The VSTM2L vstm2l (Catalog #AAA648858) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VSTM2L (C20orf102, V-set and Transmembrane Domain-containing Protein 2-like Protein, DJ1118M15.2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VSTM2L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the VSTM2L vstm2l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGAPLAVALG ALHYLALFLQ LGGATRPAGH APWDNHVSGH ALFTETPHDM TARTGEDVEM ACSFRGSGSP SYSLEIQWWY VRSHRDWTDK QAWASNQLKA SQQEDAGKEA TKISVVKVVG SNISHKLRLS RVKPTDEGTY ECRVIDFSDG KARHHKVKAY LRVQPGENSV LHLPEAPPAA PAPPPPKPGK ELRKRSVDQE ACSL. It is sometimes possible for the material contained within the vial of "VSTM2L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.