Western Blot (WB)
(Host: RabbitTarget Name: VSNL1Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human VSNL1 Polyclonal Antibody | anti-VSNL1 antibody
VSNL1 Antibody - middle region
Gene Names
VSNL1; HLP3; VILIP; HPCAL3; HUVISL1; VILIP-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
VSNL1; Polyclonal Antibody; VSNL1 Antibody - middle region; anti-VSNL1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEF
Sequence Length
191
Applicable Applications for anti-VSNL1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human VSNL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: VSNL1Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: VSNL1Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-VSNL1 antibody
This gene is a member of the visinin/recoverin subfamily of neuronal calcium sensor proteins. The encoded protein is strongly expressed in granule cells of the cerebellum where it associates with membranes in a calcium-dependent manner and modulates intracellular signaling pathways of the central nervous system by directly or indirectly regulating the activity of adenylyl cyclase. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined.
Product Categories/Family for anti-VSNL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22 kDa
NCBI Official Full Name
visinin-like protein 1 isoform 1
NCBI Official Synonym Full Names
visinin like 1
NCBI Official Symbol
VSNL1
NCBI Official Synonym Symbols
HLP3; VILIP; HPCAL3; HUVISL1; VILIP-1
NCBI Protein Information
visinin-like protein 1
UniProt Protein Name
Visinin-like protein 1
Protein Family
UniProt Gene Name
VSNL1
UniProt Synonym Gene Names
VISL1; VILIP; VLP-1; HLP3
UniProt Entry Name
VISL1_HUMAN
NCBI Description
This gene is a member of the visinin/recoverin subfamily of neuronal calcium sensor proteins. The encoded protein is strongly expressed in granule cells of the cerebellum where it associates with membranes in a calcium-dependent manner and modulates intracellular signaling pathways of the central nervous system by directly or indirectly regulating the activity of adenylyl cyclase. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined. [provided by RefSeq, Jul 2008]
Uniprot Description
VSNL1: Regulates (in vitro) the inhibition of rhodopsin phosphorylation in a calcium-dependent manner. Belongs to the recoverin family.
Chromosomal Location of Human Ortholog: 2p24.3
Molecular Function: calcium ion binding
Biological Process: calcium-mediated signaling
Research Articles on VSNL1
Similar Products
Product Notes
The VSNL1 vsnl1 (Catalog #AAA3220827) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VSNL1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VSNL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VSNL1 vsnl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LEIIEAIYKM VGTVIMMKMN EDGLTPEQRV DKIFSKMDKN KDDQITLDEF. It is sometimes possible for the material contained within the vial of "VSNL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
