Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of VPS4A expression in transfected 293T cell line by VPS4A polyclonal antibody. Lane 1: VPS4A transfected lysate (48.07kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human VPS4A Polyclonal Antibody | anti-VPS4A antibody

VPS4A (Vacuolar Protein Sorting-associated Protein 4A, VPS4, hVPS4, Protein SKD2, VPS4-1)

Gene Names
VPS4A; SKD1; SKD2; VPS4; SKD1A; VPS4-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
VPS4A; Polyclonal Antibody; VPS4A (Vacuolar Protein Sorting-associated Protein 4A; VPS4; hVPS4; Protein SKD2; VPS4-1); Anti -VPS4A (Vacuolar Protein Sorting-associated Protein 4A; anti-VPS4A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human VPS4A.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNADDLLKVKKFSEDFGQES
Applicable Applications for anti-VPS4A antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human VPS4A, aa1-437 (NP_037377.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of VPS4A expression in transfected 293T cell line by VPS4A polyclonal antibody. Lane 1: VPS4A transfected lysate (48.07kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of VPS4A expression in transfected 293T cell line by VPS4A polyclonal antibody. Lane 1: VPS4A transfected lysate (48.07kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-VPS4A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,898 Da
NCBI Official Full Name
vacuolar protein sorting-associated protein 4A
NCBI Official Synonym Full Names
vacuolar protein sorting 4 homolog A (S. cerevisiae)
NCBI Official Symbol
VPS4A
NCBI Official Synonym Symbols
SKD1; SKD2; VPS4; SKD1A; VPS4-1
NCBI Protein Information
vacuolar protein sorting-associated protein 4A; hVPS4; SKD1-homolog; vacuolar sorting protein 4; vacuolar protein sorting factor 4A
UniProt Protein Name
Vacuolar protein sorting-associated protein 4A
UniProt Gene Name
VPS4A
UniProt Synonym Gene Names
VPS4; hVPS4
UniProt Entry Name
VPS4A_HUMAN

NCBI Description

The protein encoded by this gene is a member of the AAA protein family (ATPases associated with diverse cellular activities), and is the homolog of the yeast Vps4 protein. In humans, two paralogs of the yeast protein have been identified. The former share a high degree of aa sequence similarity with each other, and also with yeast Vps4 and mouse Skd1 proteins. The mouse Skd1 (suppressor of K+ transport defect 1) has been shown to be really an yeast Vps4 ortholog. Functional studies indicate that both human paralogs associate with the endosomal compartments, and are involved in intracellular protein trafficking, similar to Vps4 protein in yeast. The gene encoding this paralog has been mapped to chromosome 16; the gene for the other resides on chromosome 18. [provided by RefSeq, Jul 2008]

Uniprot Description

VPS4A: Involved in late steps of the endosomal multivesicular bodies (MVB) pathway. Recognizes membrane-associated ESCRT-III assemblies and catalyzes their disassembly, possibly in combination with membrane fission. Redistributes the ESCRT-III components to the cytoplasm for further rounds of MVB sorting. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. In conjunction with the ESCRT machinery also appears to function in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and enveloped virus budding (HIV-1 and other lentiviruses). Involved in cytokinesis. Belongs to the AAA ATPase family.

Protein type: Vesicle; EC 3.6.4.6

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: spindle pole; centrosome; perinuclear region of cytoplasm; late endosome membrane; cytoplasm; midbody; nucleus; cytosol

Molecular Function: protein C-terminus binding; protein domain specific binding; protein binding; ATPase activity, coupled; microtubule-severing ATPase activity; ATP binding

Biological Process: cell separation during cytokinesis; ubiquitin-dependent protein catabolic process via the multivesicular body pathway; viral reproduction; cytokinesis; viral infectious cycle; endosome transport; mitotic metaphase plate congression; negative regulation of cytokinesis; cytoplasmic microtubule organization and biogenesis; vesicle-mediated transport; protein transport; abscission; nuclear organization and biogenesis; vacuole organization and biogenesis

Research Articles on VPS4A

Similar Products

Product Notes

The VPS4A vps4a (Catalog #AAA6006256) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The VPS4A (Vacuolar Protein Sorting-associated Protein 4A, VPS4, hVPS4, Protein SKD2, VPS4-1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VPS4A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the VPS4A vps4a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTTSTLQKAI DLVTKATEED KAKNYEEALR LYQHAVEYFL HAIKYEAHSD KAKESIRAKC VQYLDRAEKL KDYLRSKEKH GKKPVKENQS EGKGSDSDSE GDNPEKKKLQ EQLMGAVVME KPNIRWNDVA GLEGAKEALK EAVILPIKFP HLFTGKRTPW RGILLFGPPG TGKSYLAKAV ATEANNSTFF SVSSSDLMSK WLGESEKLVK NLFELARQHK PSIIFIDEVD SLCGSRNENE SEAARRIKTE FLVQMQGVGN NNDGTLVLGA TNIPWVLDSA IRRRFEKRIY IPLPEEAARA QMFRLHLGST PHNLTDANIH ELARKTEGYS GADISIIVRD SLMQPVRKVQ SATHFKKVCG PSRTNPSMMI DDLLTPCSPG DPGAMEMTWM DVPGDKLLEP VVCMSDMLRS LATTRPTVNA DDLLKVKKFS EDFGQES. It is sometimes possible for the material contained within the vial of "VPS4A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.