Rabbit anti-Human VPS4A Polyclonal Antibody | anti-VPS4A antibody

VPS4A Polyclonal Antibody

Cat. Num. AAA9133457

• Gene Names: VPS4A; SKD1; SKD2; VPS4; SKD1A; VPS4-1
• Reactivity: Human
• Applications: Immunofluorescence
• Purity: Affinity Purification
• Synonyms: VPS4A; Polyclonal Antibody; VPS4A Polyclonal Antibody; SKD1; SKD1A; SKD2; VPS4; VPS4-1; anti-VPS4A antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Sequence: MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVME
• Sequence Length: 437

• Applicable Applications for anti-VPS4A antibody: Immunofluorescence (IF)
• Application Notes: IF: 1:50 - 1:200
• Immunogen: Recombinant protein of human VPS4A
• Immunogen Species: Human
• Storage Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Cellular Location: Late endosome membrane, Midbody, Peripheral membrane protein, Prevacuolar compartment membrane
• Preparation and Storage: Store at -20 degree C. Avoid freeze / thaw cycles.

Immunofluorescence (IF)

(Immunofluorescence analysis of A549 cells using VPS4A antibody. Blue: DAPI for nuclear staining.)

Related Product Information for anti-VPS4A antibody

The protein encoded by this gene is a member of the AAA protein family (ATPases associated with diverse cellular activities), and is the homolog of the yeast Vps4 protein. In humans, two paralogs of the yeast protein have been identified. The former share a high degree of aa sequence similarity with each other, and also with yeast Vps4 and mouse Skd1 proteins. The mouse Skd1 (suppressor of K+ transport defect 1) has been shown to be really an yeast Vps4 ortholog. Functional studies indicate that both human paralogs associate with the endosomal compartments, and are involved in intracellular protein trafficking, similar to Vps4 protein in yeast. The gene encoding this paralog has been mapped to chromosome 16; the gene for the other resides on chromosome 18.

Product Categories/Family for anti-VPS4A antibody

Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 7019569
• NCBI GeneID: 27183
• NCBI Accession #: NP_037377.1
• NCBI GenBank Nucleotide #: NM_013245.2
• UniProt Accession #: Q9UN37; Q8TF07; Q9UI03; Q9Y582; B2RCB7
• Molecular Weight: 48kDa
• NCBI Official Full Name: vacuolar protein sorting-associated protein 4A
• NCBI Official Synonym Full Names: vacuolar protein sorting 4 homolog A
• NCBI Official Symbol: VPS4A
• NCBI Official Synonym Symbols: SKD1; SKD2; VPS4; SKD1A; VPS4-1
• NCBI Protein Information: vacuolar protein sorting-associated protein 4A
• UniProt Protein Name: Vacuolar protein sorting-associated protein 4A
• Protein Family: Vacuolar protein sorting-associated protein
• UniProt Gene Name: VPS4A
• UniProt Synonym Gene Names: hVPS4

NCBI Description

The protein encoded by this gene is a member of the AAA protein family (ATPases associated with diverse cellular activities), and is the homolog of the yeast Vps4 protein. In humans, two paralogs of the yeast protein have been identified. The former share a high degree of aa sequence similarity with each other, and also with yeast Vps4 and mouse Skd1 proteins. The mouse Skd1 (suppressor of K+ transport defect 1) has been shown to be really an yeast Vps4 ortholog. Functional studies indicate that both human paralogs associate with the endosomal compartments, and are involved in intracellular protein trafficking, similar to Vps4 protein in yeast. The gene encoding this paralog has been mapped to chromosome 16; the gene for the other resides on chromosome 18. [provided by RefSeq, Jul 2008]

Uniprot Description

Involved in late steps of the endosomal multivesicular bodies (MVB) pathway. Recognizes membrane-associated ESCRT-III assemblies and catalyzes their disassembly, possibly in combination with membrane fission. Redistributes the ESCRT-III components to the cytoplasm for further rounds of MVB sorting. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. In conjunction with the ESCRT machinery also appears to function in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and enveloped virus budding (HIV-1 and other lentiviruses). Involved in cytokinesis: retained at the midbody by ZFYVE19/ANCHR and CHMP4C until abscission checkpoint signaling is terminated at late cytokinesis. It is then released following dephosphorylation of CHMP4C, leading to abscission (PubMed:24814515). VPS4A/B are required for the exosomal release of SDCBP, CD63 and syndecan (PubMed:22660413).