Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-VPS37A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)

Rabbit VPS37A Polyclonal Antibody | anti-VPS37A antibody

VPS37A antibody - N-terminal region

Gene Names
VPS37A; HCRP1; PQBP2; SPG53
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
VPS37A; Polyclonal Antibody; VPS37A antibody - N-terminal region; anti-VPS37A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVE
Sequence Length
397
Applicable Applications for anti-VPS37A antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 82%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human VPS37A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-VPS37A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)

Western Blot (WB) (WB Suggested Anti-VPS37A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)
Related Product Information for anti-VPS37A antibody
This is a rabbit polyclonal antibody against VPS37A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: VPS37A is a component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. VPS37A may be involved in cell growth and differentiation.
Product Categories/Family for anti-VPS37A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
vacuolar protein sorting-associated protein 37A isoform 1
NCBI Official Synonym Full Names
VPS37A subunit of ESCRT-I
NCBI Official Symbol
VPS37A
NCBI Official Synonym Symbols
HCRP1; PQBP2; SPG53
NCBI Protein Information
vacuolar protein sorting-associated protein 37A
UniProt Protein Name
Vacuolar protein sorting-associated protein 37A
UniProt Gene Name
VPS37A
UniProt Synonym Gene Names
HCRP1; hVps37A
UniProt Entry Name
VP37A_HUMAN

NCBI Description

This gene belongs to the VPS37 family, and encodes a component of the ESCRT-I (endosomal sorting complex required for transport I) protein complex, required for the sorting of ubiquitinated transmembrane proteins into internal vesicles of multivesicular bodies. Expression of this gene is downregulated in hepatocellular carcinoma, and mutations in this gene are associated with autosomal recessive spastic paraplegia-53. A related pseudogene has been identified on chromosome 5. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2012]

Uniprot Description

VPS37A: Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. May be involved in cell growth and differentiation. Defects in VPS37A are a cause of autosomal recessive complex hereditary spastic paraparesis, a complicated form of hereditary spastic paraplegia (HSP). HSP is a heterogeneous group of neurodegenerative disorders characterized by progressive lower limb spasticity, retrograde degeneration of the crossed cortico- spinal tracts and thinning of the posterior columns in the spinal cord. Complicated forms are characterized by the addition of such neurological features as spastic quadriparesis, seizures, dementia, amyotrophy, extrapyramidal disturbance, cerebral or cerebellar atrophy, optic atrophy, and peripheral neuropathy, as well as by extra neurological manifestations such as dysmorphism, albinism, retinitis pigmentosa, deafness, dementia, amyotrophy and ichthyosis. Individuals with VPS37A mutations present with pronounced early onset spastic paraparesis of upper and lower limbs, mild intellectual disability, kyphosis, pectus carinatum and hypertrichosis. Belongs to the VPS37 family. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 8p22

Cellular Component: nucleoplasm; centrosome; intracellular membrane-bound organelle; late endosome membrane; cytoplasm; endosome membrane

Biological Process: protein transport; viral reproduction; ubiquitin-dependent protein catabolic process via the multivesicular body pathway; viral protein processing; viral infectious cycle; virus assembly; endosome transport

Disease: Spastic Paraplegia 53, Autosomal Recessive

Research Articles on VPS37A

Similar Products

Product Notes

The VPS37A vps37a (Catalog #AAA3211064) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VPS37A antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's VPS37A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VPS37A vps37a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SWLFPLTKSA SSSAAGSPGG LTSLQQQKQR LIESLRNSHS SIAEIQKDVE. It is sometimes possible for the material contained within the vial of "VPS37A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.