Western Blot (WB)
(Western Blot analysis of TMEM49 expression in transfected 293T cell line by TMEM49 polyclonal antibody. Lane 1: TMEM49 transfected lysate (44.66kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human VMP1 Polyclonal Antibody | anti-VMP1 antibody
VMP1 (Vacuole Membrane Protein 1, Transmembrane Protein 49, TMEM49, EPG3, HSPC292, TANGO5, TDC1)
Gene Names
VMP1; EPG3; TANGO5; TMEM49
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
VMP1; Polyclonal Antibody; VMP1 (Vacuole Membrane Protein 1; Transmembrane Protein 49; TMEM49; EPG3; HSPC292; TANGO5; TDC1); Anti -VMP1 (Vacuole Membrane Protein 1; anti-VMP1 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TMEM49.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQYFSLEILVILKEWTSKLWHRQSIVVSFLLLLAVLIATYYVEGVHQQYVQRIEKQFLLYAYWIGLGILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAESAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSYAKRIQQRLNSEEKTK
Applicable Applications for anti-VMP1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human TMEM49, aa1-406 (NP_112200).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of TMEM49 expression in transfected 293T cell line by TMEM49 polyclonal antibody. Lane 1: TMEM49 transfected lysate (44.66kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of TMEM49 expression in transfected 293T cell line by TMEM49 polyclonal antibody. Lane 1: TMEM49 transfected lysate (44.66kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-VMP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
46,238 Da
NCBI Official Full Name
vacuole membrane protein 1
NCBI Official Synonym Full Names
vacuole membrane protein 1
NCBI Official Symbol
VMP1
NCBI Official Synonym Symbols
EPG3; TANGO5; TMEM49
NCBI Protein Information
vacuole membrane protein 1; transmembrane protein 49; transport and golgi organization 5 homolog; ectopic P-granules autophagy protein 3 homolog
UniProt Protein Name
Vacuole membrane protein 1
Protein Family
UniProt Gene Name
VMP1
UniProt Synonym Gene Names
TDC1; TMEM49
UniProt Entry Name
VMP1_HUMAN
Uniprot Description
VMP1: Stress-induced protein that, when overexpressed, promotes formation of intracellular vacuoles followed by cell death. May be involved in the cytoplasmic vacuolization of acinar cells during the early stage of acute pancreatitis. Plays a role in the initial stages of the autophagic process through its interaction with BECN1. Involved in cell-cell adhesion. Plays an essential role in formation of cell junctions. Interacts with BECN1. Interacts with TJP1. Interacts with TP53INP2. Belongs to the VMP1 family.
Protein type: Endoplasmic reticulum; Membrane protein, integral; Membrane protein, multi-pass
Chromosomal Location of Human Ortholog: 17q23.1
Cellular Component: ER-Golgi intermediate compartment membrane; membrane; endoplasmic reticulum; plasma membrane; integral to membrane
Molecular Function: protein binding
Biological Process: endoplasmic reticulum organization and biogenesis; cell-cell adhesion; exocytosis; autophagy; regulation of autophagy; Golgi organization and biogenesis; embryo implantation
Research Articles on VMP1
Similar Products
Product Notes
The VMP1 vmp1 (Catalog #AAA6010426) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The VMP1 (Vacuole Membrane Protein 1, Transmembrane Protein 49, TMEM49, EPG3, HSPC292, TANGO5, TDC1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VMP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the VMP1 vmp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAENGKNCDQ RRVAMNKEHH NGNFTDPSSV NEKKRREREE RQNIVLWRQP LITLQYFSLE ILVILKEWTS KLWHRQSIVV SFLLLLAVLI ATYYVEGVHQ QYVQRIEKQF LLYAYWIGLG ILSSVGLGTG LHTFLLYLGP HIASVTLAAY ECNSVNFPEP PYPDQIICPD EEGTEGTISL WSIISKVRIE ACMWGIGTAI GELPPYFMAR AARLSGAEPD DEEYQEFEEM LEHAESAQDF ASRAKLAVQK LVQKVGFFGI LACASIPNPL FDLAGITCGH FLVPFWTFFG ATLIGKAIIK MHIQKIFVII TFSKHIVEQM VAFIGAVPGI GPSLQKPFQE YLEAQRQKLH HKSEMGTPQG ENWLSWMFEK LVVVMVCYFI LSIINSMAQS YAKRIQQRLN SEEKTK. It is sometimes possible for the material contained within the vial of "VMP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
