Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using VGLL4 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)
Rabbit anti-Mouse, Rat VGLL4 Polyclonal Antibody | anti-VGLL4 antibody
VGLL4 Rabbit pAb
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
VGLL4; Polyclonal Antibody; VGLL4 Rabbit pAb; VGL-4; anti-VGLL4 antibody
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
NGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTSLPSLGLEQPLALTKNSLDASRPAGLSPTLTPGERQQNRPSVITCASAGARNCNLSHCPIAHSGCAAPGPASYRRPPSAATTCDPVVEEHFRRSLGKNYKEPEPAPNSVSITGSVDDHFAKALGDTWLQIKAAKDGASSSPESASRRGQPASPSAHMVSHSHSPSVVS
Applicable Applications for anti-VGLL4 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Customer Validation: WB: Mouse
Customer Validation: WB: Mouse
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 96-296 of human VGLL4 (NP_001121691.1).
Positive Samples
Mouse spleen, Rat lung, Rat spleen
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using VGLL4 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using VGLL4 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
transcription cofactor vestigial-like protein 4 isoform a
UniProt Protein Name
Transcription cofactor vestigial-like protein 4
Protein Family
UniProt Gene Name
VGLL4
UniProt Synonym Gene Names
KIAA0121; Vgl-4
UniProt Entry Name
VGLL4_HUMAN
Similar Products
Product Notes
The VGLL4 vgll4 (Catalog #AAA9142598) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VGLL4 Rabbit pAb reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's VGLL4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000 Customer Validation: WB: Mouse. Researchers should empirically determine the suitability of the VGLL4 vgll4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NGDCRRDPRE RSRSPIERAV APTMSLHGSH LYTSLPSLGL EQPLALTKNS LDASRPAGLS PTLTPGERQQ NRPSVITCAS AGARNCNLSH CPIAHSGCAA PGPASYRRPP SAATTCDPVV EEHFRRSLGK NYKEPEPAPN SVSITGSVDD HFAKALGDTW LQIKAAKDGA SSSPESASRR GQPASPSAHM VSHSHSPSVV S. It is sometimes possible for the material contained within the vial of "VGLL4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
