Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: VCAM1Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human VCAM1 Polyclonal Antibody | anti-VCAM1 antibody

VCAM1 Antibody - C-terminal region

Gene Names
VCAM1; CD106; INCAM-100
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
VCAM1; Polyclonal Antibody; VCAM1 Antibody - C-terminal region; anti-VCAM1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SKNKVGSQLRSLTLDVQGRENNKDYFSPELLVLYFASSLIIPAIGMIIYF
Sequence Length
739
Applicable Applications for anti-VCAM1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human VCAM1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: VCAM1Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: VCAM1Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-VCAM1 antibody
This is a rabbit polyclonal antibody against VCAM1. It was validated on Western Blot

Target Description: This gene is a member of the Ig superfamily and encodes a cell surface sialoglycoprotein expressed by cytokine-activated endothelium. This type I membrane protein mediates leukocyte-endothelial cell adhesion and signal transduction, and may play a role in the development of artherosclerosis and rheumatoid arthritis. Three alternatively spliced transcripts encoding different isoforms have been described for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
81kDa
NCBI Official Full Name
Vascular cell adhesion protein 1
NCBI Official Synonym Full Names
vascular cell adhesion molecule 1
NCBI Official Symbol
VCAM1
NCBI Official Synonym Symbols
CD106; INCAM-100
NCBI Protein Information
vascular cell adhesion protein 1
UniProt Protein Name
Vascular cell adhesion protein 1
UniProt Gene Name
VCAM1
UniProt Synonym Gene Names
L1CAM; V-CAM 1; VCAM-1
UniProt Entry Name
VCAM1_HUMAN

NCBI Description

This gene is a member of the Ig superfamily and encodes a cell surface sialoglycoprotein expressed by cytokine-activated endothelium. This type I membrane protein mediates leukocyte-endothelial cell adhesion and signal transduction, and may play a role in the development of artherosclerosis and rheumatoid arthritis. Three alternatively spliced transcripts encoding different isoforms have been described for this gene. [provided by RefSeq, Dec 2010]

Uniprot Description

VCAM1: Important in cell-cell recognition. Appears to function in leukocyte-endothelial cell adhesion. Interacts with the beta-1 integrin VLA4 on leukocytes, and mediates both adhesion and signal transduction. The VCAM1/VLA4 interaction may play a pathophysiologic role both in immune responses and in leukocyte emigration to sites of inflammation. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: 1p32-p31

Cellular Component: Golgi apparatus; extracellular space; cell surface; microvillus; endoplasmic reticulum; early endosome; integral to membrane; apical part of cell; plasma membrane; podosome; sarcolemma; filopodium; external side of plasma membrane

Molecular Function: amine oxidase activity; integrin binding; cell adhesion molecule binding

Biological Process: response to nicotine; chronic inflammatory response; extracellular matrix organization and biogenesis; regulation of immune response; viral reproduction; cell-matrix adhesion; cytokine and chemokine mediated signaling pathway; heart development; response to lipopolysaccharide; heterophilic cell adhesion; leukocyte adhesion; response to ethanol; response to zinc ion; B cell differentiation; membrane to membrane docking; response to hypoxia; positive regulation of T cell proliferation; amine metabolic process; response to ionizing radiation; cell adhesion; leukocyte tethering or rolling; response to nutrient; acute inflammatory response; aging

Research Articles on VCAM1

Similar Products

Product Notes

The VCAM1 vcam1 (Catalog #AAA3219631) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VCAM1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VCAM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VCAM1 vcam1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SKNKVGSQLR SLTLDVQGRE NNKDYFSPEL LVLYFASSLI IPAIGMIIYF. It is sometimes possible for the material contained within the vial of "VCAM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.