Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Vamp1 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Lung)

Rabbit Vamp1 Polyclonal Antibody | anti-VAMP1 antibody

Vamp1 antibody - C-terminal region

Gene Names
Vamp1; Syb1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Vamp1; Polyclonal Antibody; Vamp1 antibody - C-terminal region; anti-VAMP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELDDRADALQAGASVFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIV
Sequence Length
118
Applicable Applications for anti-VAMP1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Vamp1 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Lung)

Western Blot (WB) (WB Suggested Anti-Vamp1 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Lung)
Related Product Information for anti-VAMP1 antibody
This is a rabbit polyclonal antibody against Vamp1. It was validated on Western Blot

Target Description: Vamp1 plays a role in protein transport to the plasma membrane.
Product Categories/Family for anti-VAMP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13kDa
NCBI Official Full Name
vesicle-associated membrane protein 1
NCBI Official Synonym Full Names
vesicle-associated membrane protein 1
NCBI Official Symbol
Vamp1
NCBI Official Synonym Symbols
Syb1
NCBI Protein Information
vesicle-associated membrane protein 1
UniProt Protein Name
Vesicle-associated membrane protein 1
UniProt Gene Name
Vamp1
UniProt Synonym Gene Names
Syb1
UniProt Entry Name
VAMP1_RAT

NCBI Description

plays a role in protein transport to the plasma membrane [RGD, Feb 2006]

Uniprot Description

VAMP1: Involved in the targeting and/or fusion of transport vesicles to their target membrane. Belongs to the synaptobrevin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Cellular Component: SNARE complex; mitochondrial outer membrane; synaptic vesicle; cell surface; cytoplasmic vesicle membrane; synaptic vesicle membrane; mitochondrion; integral to membrane; terminal button; cytosol; cell junction

Molecular Function: SNAP receptor activity; protein binding; SNARE binding

Biological Process: vesicle-mediated transport; vesicle fusion; intracellular protein transport; exocytosis; neurotransmitter secretion

Research Articles on VAMP1

Similar Products

Product Notes

The VAMP1 vamp1 (Catalog #AAA3214361) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Vamp1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Vamp1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VAMP1 vamp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELDDRADALQ AGASVFESSA AKLKRKYWWK NCKMMIMLGA ICAIIVVVIV. It is sometimes possible for the material contained within the vial of "Vamp1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.