Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using UTP6 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
Rabbit UTP6 Polyclonal Antibody | anti-UTP6 antibody
UTP6 Rabbit pAb
Gene Names
UTP6; HCA66; C17orf40
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
UTP6; Polyclonal Antibody; UTP6 Rabbit pAb; C17orf40; HCA66; anti-UTP6 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MAEIIQERIEDRLPELEQLERIGLFSHAEIKAIIKKASDLEYKIQRRTLFKEDFINYVQYEINLLELIQRRRTRIGYSFKKDEIENSIVHRVQGVFQRASAKWKDDVQLWLSYVAFCKKWATKTRLSKVFSAMLAIHSNKPALWIMAAKWEMEDRLSSESARQLFLRALRFHPECPKLYKEYFRMELMHAEKLRKEKEEFEKASMDVENPDYSEEILKGE
Applicable Applications for anti-UTP6 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human UTP6 (NP_060898.2).
Positive Samples
HT-29, HeLa, Mouse lung, Mouse thymus, Mouse spleen, Rat lung, Rat thymus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using UTP6 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using UTP6 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
70,194 Da
NCBI Official Full Name
U3 small nucleolar RNA-associated protein 6 homolog
NCBI Official Synonym Full Names
UTP6, small subunit (SSU) processome component, homolog (yeast)
NCBI Official Symbol
UTP6
NCBI Official Synonym Symbols
HCA66; C17orf40
NCBI Protein Information
U3 small nucleolar RNA-associated protein 6 homolog; hepatocellular carcinoma associated antigen 66; hepatocellular carcinoma-associated antigen 66; multiple hat domains protein
UniProt Protein Name
U3 small nucleolar RNA-associated protein 6 homolog
Protein Family
UniProt Gene Name
UTP6
UniProt Synonym Gene Names
C17orf40; HCA66; MHAT
UniProt Entry Name
UTP6_HUMAN
Similar Products
Product Notes
The UTP6 utp6 (Catalog #AAA9142973) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UTP6 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UTP6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the UTP6 utp6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAEIIQERIE DRLPELEQLE RIGLFSHAEI KAIIKKASDL EYKIQRRTLF KEDFINYVQY EINLLELIQR RRTRIGYSFK KDEIENSIVH RVQGVFQRAS AKWKDDVQLW LSYVAFCKKW ATKTRLSKVF SAMLAIHSNK PALWIMAAKW EMEDRLSSES ARQLFLRALR FHPECPKLYK EYFRMELMHA EKLRKEKEEF EKASMDVENP DYSEEILKGE. It is sometimes possible for the material contained within the vial of "UTP6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
