Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: USP43Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human USP43 Polyclonal Antibody | anti-USP43 antibody

USP43 Antibody - C-terminal region

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
USP43; Polyclonal Antibody; USP43 Antibody - C-terminal region; anti-USP43 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KSSPPSPYMGFSGNSKDSRRGTSELDRPLQGTLTLLRSVFRKKENRRNER
Sequence Length
635
Applicable Applications for anti-USP43 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human USP43
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: USP43Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: USP43Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-USP43 antibody
This is a rabbit polyclonal antibody against USP43. It was validated on Western Blot

Target Description: USP43 may recognize and hydrolyze the peptide bond at the C-terminal Gly of ubiquitin. It is involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins.
Product Categories/Family for anti-USP43 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase 43 isoform 2
NCBI Official Synonym Full Names
ubiquitin specific peptidase 43
NCBI Official Symbol
USP43
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase 43
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase 43
UniProt Gene Name
USP43
UniProt Entry Name
UBP43_HUMAN

Uniprot Description

USP43: May recognize and hydrolyze the peptide bond at the C- terminal Gly of ubiquitin. Involved in the processing of poly- ubiquitin precursors as well as that of ubiquitinated proteins. Belongs to the peptidase C19 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.19.12; Ubiquitin-specific protease; Protease

Chromosomal Location of Human Ortholog: 17p13.1

Molecular Function: cysteine-type endopeptidase activity; ubiquitin-specific protease activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; protein deubiquitination

Research Articles on USP43

Similar Products

Product Notes

The USP43 usp43 (Catalog #AAA3219020) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The USP43 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's USP43 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the USP43 usp43 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KSSPPSPYMG FSGNSKDSRR GTSELDRPLQ GTLTLLRSVF RKKENRRNER. It is sometimes possible for the material contained within the vial of "USP43, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.