Rabbit USP22 Polyclonal Antibody | anti-USP22 antibody

USP22 antibody - middle region

Cat. Num. AAA3213852

• Gene Names: USP22; USP3L
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: USP22; Polyclonal Antibody; USP22 antibody - middle region; anti-USP22 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: PSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWTHARHLAGYEQQDAHE
• Sequence Length: 525

• Applicable Applications for anti-USP22 antibody: Western Blot (WB)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human USP22
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: USP22Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: USP22Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: USP22Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-USP22 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)

Related Product Information for anti-USP22 antibody

This is a rabbit polyclonal antibody against USP22. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: USP22 is a subunit of the SAGA transcriptional cofactor complex. It deubiquitylates histone H2B and is recruited to specific genes by activators like Myc. USP22 is needed for cell cycle progression. It deubiquitylates histone H2A in addition to H2B. Altered mRNA expression is associated with therapy failure and death in patients multiple types of cancer.

Product Categories/Family for anti-USP22 antibody

Polyclonal; Transcription Regulation; Chromatin & Nuclear Signaling; Various; E3 & Ubiquitin; Disease Related; Meiosis/Mitosis/Cell Cycle; Acetylation; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 150010639
• NCBI GeneID: 23326
• NCBI Accession #: NP_056091
• NCBI GenBank Nucleotide #: NM_015276
• UniProt Accession #: Q9UPT9
• Molecular Weight: 60kDa
• NCBI Official Full Name: ubiquitin carboxyl-terminal hydrolase 22
• NCBI Official Synonym Full Names: ubiquitin specific peptidase 22
• NCBI Official Symbol: USP22
• NCBI Official Synonym Symbols: USP3L
• NCBI Protein Information: ubiquitin carboxyl-terminal hydrolase 22
• UniProt Protein Name: Ubiquitin carboxyl-terminal hydrolase 22
• UniProt Gene Name: USP22
• UniProt Synonym Gene Names: KIAA1063; USP3L
• UniProt Entry Name: UBP22_HUMAN

Uniprot Description

USP22: Histone deubiquitinating component of the transcription regulatory histone acetylation (HAT) complex SAGA. Catalyzes the deubiquitination of both histones H2A and H2B, thereby acting as a coactivator. Recruited to specific gene promoters by activators such as MYC, where it is required for transcription. Required for nuclear receptor-mediated transactivation and cell cycle progression. Belongs to the peptidase C19 family. UBP8 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin-specific protease; Ubiquitin conjugating system; Transcription, coactivator/corepressor; Cell cycle regulation; Nuclear receptor co-regulator; Protease; EC 3.4.19.12

Chromosomal Location of Human Ortholog: 17p11.2

Molecular Function: protein binding; H4 histone acetyltransferase activity; enzyme binding; ligand-dependent nuclear receptor transcription coactivator activity; zinc ion binding; cysteine-type endopeptidase activity; transcription coactivator activity; ubiquitin-specific protease activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; embryonic development; establishment and/or maintenance of chromatin architecture; protein deubiquitination; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; histone ubiquitination; cell cycle; positive regulation of mitotic cell cycle; histone deubiquitination